KEGG   Aiivibrio fischeri MJ11: VFMJ11_0950Help
Entry
VFMJ11_0950       CDS       T00754                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
vfm00010  Glycolysis / Gluconeogenesis
vfm01100  Metabolic pathways
vfm01110  Biosynthesis of secondary metabolites
vfm01120  Microbial metabolism in diverse environments
vfm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VFMJ11_0950
Enzymes [BR:vfm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     VFMJ11_0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim DUF11 PmrD
Motif
Other DBs
NCBI-ProteinID: ACH66146
UniProt: B5FCL1
Position
I:complement(998486..999361)
Genome map
AA seq 291 aa AA seqDB search
MNLTQLPIISVLSDNVTVAQLDDVKVIRVIHDKANAAISLHGGHVLSFTPKGQDDLIWMS
KEAIFNPEKAIRGGVPVCWPWFGRIADPAHGFARNNEWTLIEHRENDNGVIVVLGLEASE
ATKAIWPFEFEARLTVEIGDELHITLDAKNTDNKAWNCSGALHTYLNVADIASTTIMGMG
PTYIDGLQNAKLCTGEDTLSINAAVDRVYTQPENTVSVSDSQRTLTVTNSGHNAAVIWNP
WIEGAESMADMNNDGYKTMVCVESTYHATSLEEAQTVEPGSAFTLTTTIKA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttactcagcttccaattatcagtgtattatctgataacgtcactgttgctcaa
ttagatgatgtaaaagtgattcgtgtcattcatgacaaagccaatgcagccatttctctt
catggtggccatgttttatcttttacgccaaaaggacaagacgatcttatttggatgagt
aaagaagccatctttaaccctgaaaaagcaattcgtggcggtgttcctgtttgttggcca
tggtttggccgtatcgccgatcctgctcacggctttgctcgtaataatgagtggacgctt
attgaacaccgtgaaaatgataatggcgttattgtcgttctaggattagaagcatctgaa
gcaaccaaagcgatttggccttttgaatttgaagcacgcttaaccgttgaaattggtgat
gagttacatattacgcttgacgcaaaaaatacggataacaaagcatggaattgttcaggt
gctttacatacttaccttaacgttgcggatattgcctcaacaacaattatgggcatgggt
ccaacatatattgacggccttcaaaatgccaaactatgtacaggtgaagacactctatca
ataaatgctgccgttgaccgtgtatatactcaaccagaaaataccgtatcagtttcagac
tctcagcgtacattaacggtgacgaattcaggtcataatgctgcggttatttggaaccct
tggattgaaggcgctgaatcgatggctgatatgaataatgatggctacaaaaccatggtg
tgtgttgaatctacttaccacgcaactagcttagaagaagcccaaaccgttgaaccaggt
agcgcatttaccctaaccacaacgattaaagcgtaa

DBGET integrated database retrieval system