KEGG   Aiivibrio fischeri MJ11: VFMJ11_0957Help
Entry
VFMJ11_0957       CDS       T00754                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    VFMJ11_0957
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VFMJ11_0957
   00620 Pyruvate metabolism
    VFMJ11_0957
   00650 Butanoate metabolism
    VFMJ11_0957
  Lipid metabolism
   00071 Fatty acid degradation
    VFMJ11_0957
  Amino acid metabolism
   00350 Tyrosine metabolism
    VFMJ11_0957
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VFMJ11_0957
   00626 Naphthalene degradation
    VFMJ11_0957
Enzymes [BR:vfm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     VFMJ11_0957
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     VFMJ11_0957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1004369..1007044
Genome map
AA seq 891 aa AA seqDB search
MPVTNLAELDALVARVKAAQEEFATFSQEQVDAIFRAASLAANQARIPLAQQAVAESGMG
IVEDKVIKNHFASEFIYNKYKDEKTCGILEEDDNLGTMTIAEPVGIICGIVPTTNPTSTA
IFKSLISLKTRNGIIFSPHPRAKNSTNDAAKLVLDAAVAAGAPKDIIGWIDQPSVELSNA
LMKHDGIALILATGGPGMVKAAYSSGKPAIGVGAGNVPVVIDDTADVKRAVASVLMSKTF
DNGVVCASEQAVIVMDEVYDEVKERFASHKGYVLSKAEADKVRKVLLIDGNLNANIVGQP
ATAIAEMAGVKVPADTKILVGEGIGEVSYDDEFAHEKLSPTLGMFRASSFENAVDQAVKM
VEIGGIGHTSGLYTNQDVNADRIRYFGDKLKTARILVNIPTTHGGIGDLYNFNVAPSLTL
GCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIAMSDLEGKKR
AFLVTDRFLFNNGYADDVVQLLKAQGIEVQTFFDVEADPTLSVVEKGAEAMKSFQPDVIL
ALGGGSPMDAAKIMWVMYEHPETHFAELAMRFMDIRKRIYKFPKMGKKAELVCITTTSGT
GSEVTPFAVVTDDKTGAKYPLADYEITPNMAIVDANLVMNMPKSLTAFGGYDAVTHALEA
YVSVLANEYSDGQALQALKMLKEYLPSSYKNGANDPIAREKVHNAATIAGIAFANAFLGV
CHSMAHKIGAEFHLPHGLANALLISNVVRYNANDNPTKQTAFSQYDRPQARRRYAEVADH
LGLSQAGDRTAQKIERLLTWLEELKKDLDIPLSIKDAGVNEADFIAKLDELSVEAFDDQC
TGANPRYPLITELKEVLTTSYYGKPFVEGETFEGTTVIKKTEEPKAKKAKK
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaactaacctagctgaattagatgctctagtagcacgcgttaaagcagcacaa
gaagagttcgcaactttttctcaagagcaagttgatgcaatcttccgtgcagcatctcta
gcagctaaccaagctcgtatcccgctagcacaacaagcggttgctgagtctggcatgggt
atcgttgaagataaggttatcaaaaaccacttcgcatcagagttcatctacaacaaatat
aaagatgaaaaaacatgtggcattcttgaagaagacgataacctaggaacaatgactatc
gcagaacctgtaggtattatctgtggtatcgttccaacaactaacccaacatctactgca
atcttcaaatctctaatctctctaaaaactcgtaacggtatcattttctcgccacaccca
cgtgcgaaaaactctactaatgatgcagcgaaacttgttttagacgcagcagttgcagcg
ggtgctccaaaagacatcatcggttggattgaccaaccatctgtagaactttctaatgca
ctaatgaagcacgacggtatcgctcttatccttgctactggtggtccaggcatggttaaa
gcagcatactcttcaggtaaacctgcaatcggtgttggtgctggtaacgttcctgttgtt
atcgatgacacagctgatgttaaacgtgctgtagcttctgttcttatgtctaaaacattc
gataacggcgtagtttgtgcttctgagcaagctgtaatcgtaatggatgaagtatacgac
gaagttaaagagcgttttgcttctcacaaaggttacgtactatctaaagctgaagcagat
aaagttcgtaaagttctacttatcgacggtaacctaaacgcaaacatcgtaggtcaacct
gcaacagctatcgctgaaatggctggcgttaaagttccagctgatactaagatccttgtt
ggtgaaggtatcggtgaagtatcttacgatgacgaattcgctcatgagaaactatctcca
acactaggtatgttccgtgcgtcttctttcgagaacgcggtagaccaagctgttaaaatg
gtagaaattggcggtatcggccacacatctggtctgtacactaaccaagatgttaacgct
gaccgtatccgttactttggtgacaaactaaaaacagcacgtattcttgtaaatatccca
actactcacggtggtatcggtgacctttacaactttaacgttgcaccttctctaactctt
ggttgtggttcatggggtggtaactctatctctgagaacgtgggtcctaagcaccttatc
aacaagaaaactgtagcgaagcgagctgaaaatatgttatggcacaaactacctaagtct
atctacttccgtcgtggcagccttccaatcgcaatgagcgacttagaaggtaagaaacgt
gcattccttgtaactgaccgtttcctattcaacaacggttacgctgatgacgtagttcaa
ctacttaaagctcaaggtatcgaagttcaaacattctttgatgtagaagcggatccaaca
ctatctgttgttgagaaaggcgctgaagcaatgaagagcttccaacctgacgtaatcctt
gctctaggtggtggttcaccaatggatgctgctaagatcatgtgggtaatgtacgagcac
ccagaaactcatttcgcagaactagcaatgcgctttatggatatccgtaaacgtatctac
aagttccctaaaatgggtaaaaaagctgagcttgtatgtatcactacaacttcaggtacg
ggttcagaagttactccattcgctgttgttacagacgacaagactggtgctaaataccca
ctagctgattacgaaattacgccaaacatggcaatcgttgatgctaacctagtaatgaac
atgcctaagtctctaacagcatttggtggttacgatgcagtaactcacgcattagaagct
tacgtatctgttcttgctaatgaatactctgacggtcaagcgcttcaagctcttaagatg
cttaaagaatacttaccatcaagctacaaaaatggtgcgaacgacccaatcgctcgtgag
aaagtacacaatgctgcaactatcgctggtatcgcgtttgctaacgcattcttaggtgtg
tgtcactcaatggctcacaaaatcggtgctgagttccacttaccacacggtttagcgaac
gcattacttatctctaacgttgtacgttacaacgcgaacgataacccaactaaacaaaca
gcattctctcaatacgaccgtccacaagcacgtcgtcgttacgcagaagttgctgaccac
ctaggcctaagccaagctggtgaccgtactgctcagaagattgagcgtctactaacttgg
ttagaagagcttaagaaggatttagatattccactatctatcaaagatgcaggtgttaac
gaagcagacttcatcgctaaactagatgaactatctgttgaagcgttcgatgaccaatgt
actggtgcgaaccctcgttaccctctaatcacagagctaaaagaagtattaacaacttct
tactacggtaagccttttgttgaaggtgaaacgtttgaaggcactacagtaattaaaaaa
actgaagagccaaaagcgaaaaaagcaaagaaataa

DBGET integrated database retrieval system