KEGG   Vibrio fischeri MJ11: VFMJ11_0992Help
Entry
VFMJ11_0992       CDS       T00754                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
vfm  Vibrio fischeri MJ11
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vfm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1038888..1039511
Genome map
AA seq 207 aa AA seqDB search
MIGRLRGNLLEKQPPELLIEVSGIGYEVQMPMSCFYELPEVGSEAIIYTHYVVREDAQLL
YGFNTKNERALFREVIKANGVGPKLGLAILSGMTAAQFVQSVEREDISTLVKLPGVGKKT
AERLVVEMKDRLKGWGAGDLFTPATDAAPMDDGSEFITSPQSAVDEAVSALIALGYKPQQ
ASKTVSQVAKPDMTSEVLIRESLKSMI
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgattggacgtcttcgcggaaatttattagaaaaacaaccaccagaattattgatcgaa
gtgagtggtattggctatgaagtacagatgccaatgagctgtttttatgaattaccagaa
gtgggttcggaagccattatttatactcattatgttgtacgtgaagatgcacagctacta
tatggttttaatactaaaaacgaacgagctttgtttcgtgaagtaattaaagcaaatggt
gttggccctaagctgggcttagctattctatcaggaatgacagcagcgcaatttgtacaa
agtgttgaacgtgaagatatctcaacattggttaagttacctggggttggtaaaaagaca
gcggaaagacttgtcgttgaaatgaaagatagattaaaaggatggggagcgggcgatctc
tttacaccagcgaccgatgcagcaccaatggacgatggttcagaatttatcacatctcca
caaagtgctgtggatgaagcggttagtgcattaatcgcattaggttataaaccacaacaa
gcatctaaaactgtttctcaggttgctaagccggacatgaccagtgaagtattgatccgt
gaatcattaaagtcgatgatttaa

DBGET integrated database retrieval system