KEGG   Aiivibrio fischeri MJ11: VFMJ11_1110Help
Entry
VFMJ11_1110       CDS       T00754                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VFMJ11_1110 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VFMJ11_1110 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VFMJ11_1110 (trpA)
Enzymes [BR:vfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VFMJ11_1110 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(1166131..1166937)
Genome map
AA seq 268 aa AA seqDB search
MDRYQALFAQLEKKNQGAFVPFVTIGDPNPELSYNIMETLIEAGADALELGIPFSDPLAD
GPTIQGANIRALDSKTTPAICFELIAKIRSKYPETPIGLLVYANLVFANGIDDFYAKCQQ
AGVDSVLIADVPTNESQEFRESAIEHGIHPIFIAPPSASPETLETVAKLGGGYTYLLSRA
GVTGAETKAGMPVAQLLERLNQYDAPPAILGFGISEPAQVEEAVKAGAAGAISGSATVKL
IEQHQANPEALLKALTDFTSSMKAATQK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggatcgttatcaagccctatttgctcagctagagaaaaaaaatcaaggagcctttgtt
ccattcgtaactattggcgatccaaaccctgagctatcttataacatcatggaaaccctg
attgaagctggtgccgatgcattagaattaggtattccgttttcggatcctcttgctgat
ggccctactattcaaggcgcaaacattcgagcattagatagcaaaacaacgccagctatt
tgttttgaactcattgcaaaaattcgctctaaataccctgaaacaccaatcggtctttta
gtttatgcgaaccttgttttcgctaacggtattgatgacttctacgcaaaatgccaacaa
gcaggggtagactcggtattgatcgccgatgtaccgacgaatgaatcccaagaattcaga
gaaagtgcaatagaacatggtattcaccctattttcattgcaccaccatcagcatcgcct
gaaacgctagaaacggttgctaaattaggcggtggctacacttaccttctttctcgtgca
ggtgtaaccggagctgagaccaaagcgggtatgcctgttgctcaattactagagcgtctt
aatcaatacgatgcaccacctgctattcttggttttggtatctcagagccagctcaagtg
gaagaagcggtaaaagctggagctgctggtgcgatttcaggttctgcaacggtcaaattg
attgaacaacatcaggctaacccagaagcattattaaaagcacttactgatttcacatca
tcgatgaaagcagcaacacaaaaataa

DBGET integrated database retrieval system