KEGG   Aiivibrio fischeri MJ11: VFMJ11_1544Help
Entry
VFMJ11_1544       CDS       T00754                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VFMJ11_1544 (rbsK)
Enzymes [BR:vfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     VFMJ11_1544 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1624455..1625372
Genome map
AA seq 305 aa AA seqDB search
MNKLVVLGSVNADHVLQVASFPRPGETLHGHSYSVIPGGKGANQAVAAARLGADIAFIAS
VGDDSFGHQMIEAFQFDGINTEAVMIEENTPTGIAMIQVAATGENSICISAEANARLTAD
RIAPHHGLIEAADTLLMQLETPIETIEKAAQIAKAAGTKVVLNPAPAHQLSDDLLQLVDI
ITPNETEAELLTGIQVTDMASAQQAADALHAKGIETVMITLGSKGVWISQDGSGRQVEGF
KVQATDTTGAGDTFNGAFLTGLQSGRKLDDAIKFAHAAAAISVTRMGAQTSIPSITEVER
FLLEH
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattagttgttttaggtagcgtaaacgcagaccacgttcttcaagttgcatca
ttccctcgcccaggagagacgttacacggtcacagctattccgttattcctggtggcaaa
ggcgcaaaccaagcagttgcagcagcacgcttaggggctgatatcgcatttattgcaagt
gtgggtgatgacagttttggtcaccaaatgattgaagcttttcagtttgatggcattaat
accgaagcagtaatgattgaagaaaatacaccaaccggcattgctatgatccaagtagca
gcaaccggcgaaaacagcatttgtatttcagcagaagcaaatgcgcgtttaacggcagat
cgtatcgctcctcatcacggattaatcgaagccgctgataccctattaatgcaacttgaa
acccctattgaaaccatagaaaaagcagcacaaattgccaaagcagcaggaactaaagtg
gtattaaacccagcccctgcacatcaattaagtgatgacttattacaacttgttgatatc
attacaccaaacgaaacagaagccgaactattaaccggcattcaagtaacggatatggcg
agcgctcaacaagcggctgatgcacttcatgcaaaaggtatcgagaccgtaatgatcact
cttggtagcaaaggggtttggataagccaagatggttctggtcgccaagttgaaggtttt
aaagtgcaagcgacagatacaacaggcgcaggagatacgttcaacggtgctttcctaaca
ggattacaatcaggccgtaaattggatgatgcaataaagtttgctcacgctgctgctgca
atatctgtaactcgaatgggtgctcaaacgtcaataccttcaatcactgaagtcgagcgt
tttctcttagagcattga

DBGET integrated database retrieval system