KEGG   Aiivibrio fischeri MJ11: VFMJ11_1561Help
Entry
VFMJ11_1561       CDS       T00754                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VFMJ11_1561
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VFMJ11_1561
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VFMJ11_1561
Enzymes [BR:vfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VFMJ11_1561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1643222..1644352
Genome map
AA seq 376 aa AA seqDB search
MKYICMACNKEYAPKPELIKCECGSALWVKPQTSFSKKDLIENEFTPRRYSSAFPVKKDD
INITFNEAITPLCQAEISGNPILVKLDSLQPTGSFKDRGASLVINYLNNHGITSIAEDSS
GNGGSAYAGYAAKGKMQCNIFVPAGTSKGKTTQTRLYGANCIEVEGAREDVALAAIESSV
THGSHYVGHNWHPLFIEGVKSIAYEIWEQCRYKAPDNFVVPAGNGSLLAGAYIGFSELLK
GGEISKLPRLFGIQSESIQPFVQTFNNKEINITSENTIAEGIKIKRSSRMNEIVQFVKET
NGNFISVSEQQIQSALKEMGAQGYFIEPTSATAFAGIAQLIKTQEIKPDELTVGVVTGNG
LKATNSIEHLINDMRG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatctgcatggcgtgtaataaagaatacgcacctaaacctgaactcataaaa
tgtgaatgtggctctgccctatgggttaaacctcaaacgtcatttagtaaaaaagatctc
atagaaaatgaattcacacctagacgctattctagtgctttcccagtaaaaaaagacgat
atcaacatcactttcaatgaagctatcacacctctttgccaagctgaaatatcaggaaat
ccaatactggttaaactcgattccctacaaccaacaggctcatttaaagaccgaggagcc
tcgcttgtaatcaactaccttaacaatcatggaataacgagcattgctgaagactcaagc
ggtaatggaggaagtgcttatgccggctatgccgctaaaggaaaaatgcaatgcaatata
tttgtgccagctggtacatccaaaggaaagacaacacaaacgcgattatacggcgctaac
tgtattgaagtagaaggagcaagagaagacgtcgctctagccgccatagagagcagcgtc
actcatggaagtcattatgttgggcataactggcatcccctatttatcgaaggcgtcaaa
tccatcgcttatgaaatatgggaacagtgtcggtataaagctcctgataattttgttgtt
cccgcaggaaatggaagcttacttgccggagcatatatcggtttctctgaattattaaaa
ggcggagaaataagcaaactccctcgcctttttggtattcaaagtgaaagcattcagccg
tttgttcaaacctttaacaataaagaaatcaacattacatcagaaaataccattgctgag
ggtattaagattaagcgttcatcacgtatgaatgagatcgttcaatttgtcaaagaaacg
aatgggaattttattagtgttagtgaacaacaaatccaatcagcattaaaagaaatggga
gcgcaaggatactttatcgaaccaacatcagcgacggcatttgcaggaatcgctcagctt
ataaaaacgcaagaaatcaaacctgacgagcttaccgttggtgtcgtaaccggaaatgga
ctcaaagcaacaaactcaattgaacatttaatcaatgatatgagaggttaa

DBGET integrated database retrieval system