KEGG   Vibrio fischeri MJ11: VFMJ11_1561Help
Entry
VFMJ11_1561       CDS       T00754                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vfm  Vibrio fischeri MJ11
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vfm01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:vfm00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:vfm00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1643222..1644352
Genome map
AA seq 376 aa AA seqDB search
MKYICMACNKEYAPKPELIKCECGSALWVKPQTSFSKKDLIENEFTPRRYSSAFPVKKDD
INITFNEAITPLCQAEISGNPILVKLDSLQPTGSFKDRGASLVINYLNNHGITSIAEDSS
GNGGSAYAGYAAKGKMQCNIFVPAGTSKGKTTQTRLYGANCIEVEGAREDVALAAIESSV
THGSHYVGHNWHPLFIEGVKSIAYEIWEQCRYKAPDNFVVPAGNGSLLAGAYIGFSELLK
GGEISKLPRLFGIQSESIQPFVQTFNNKEINITSENTIAEGIKIKRSSRMNEIVQFVKET
NGNFISVSEQQIQSALKEMGAQGYFIEPTSATAFAGIAQLIKTQEIKPDELTVGVVTGNG
LKATNSIEHLINDMRG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatctgcatggcgtgtaataaagaatacgcacctaaacctgaactcataaaa
tgtgaatgtggctctgccctatgggttaaacctcaaacgtcatttagtaaaaaagatctc
atagaaaatgaattcacacctagacgctattctagtgctttcccagtaaaaaaagacgat
atcaacatcactttcaatgaagctatcacacctctttgccaagctgaaatatcaggaaat
ccaatactggttaaactcgattccctacaaccaacaggctcatttaaagaccgaggagcc
tcgcttgtaatcaactaccttaacaatcatggaataacgagcattgctgaagactcaagc
ggtaatggaggaagtgcttatgccggctatgccgctaaaggaaaaatgcaatgcaatata
tttgtgccagctggtacatccaaaggaaagacaacacaaacgcgattatacggcgctaac
tgtattgaagtagaaggagcaagagaagacgtcgctctagccgccatagagagcagcgtc
actcatggaagtcattatgttgggcataactggcatcccctatttatcgaaggcgtcaaa
tccatcgcttatgaaatatgggaacagtgtcggtataaagctcctgataattttgttgtt
cccgcaggaaatggaagcttacttgccggagcatatatcggtttctctgaattattaaaa
ggcggagaaataagcaaactccctcgcctttttggtattcaaagtgaaagcattcagccg
tttgttcaaacctttaacaataaagaaatcaacattacatcagaaaataccattgctgag
ggtattaagattaagcgttcatcacgtatgaatgagatcgttcaatttgtcaaagaaacg
aatgggaattttattagtgttagtgaacaacaaatccaatcagcattaaaagaaatggga
gcgcaaggatactttatcgaaccaacatcagcgacggcatttgcaggaatcgctcagctt
ataaaaacgcaagaaatcaaacctgacgagcttaccgttggtgtcgtaaccggaaatgga
ctcaaagcaacaaactcaattgaacatttaatcaatgatatgagaggttaa

DBGET integrated database retrieval system