KEGG   Aiivibrio fischeri MJ11: VFMJ11_1652Help
Entry
VFMJ11_1652       CDS       T00754                                 

Definition
phospholipase A1 (EC:3.1.1.32 3.1.1.4)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VFMJ11_1652
   00565 Ether lipid metabolism
    VFMJ11_1652
   00590 Arachidonic acid metabolism
    VFMJ11_1652
   00591 Linoleic acid metabolism
    VFMJ11_1652
   00592 alpha-Linolenic acid metabolism
    VFMJ11_1652
Enzymes [BR:vfm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     VFMJ11_1652
    3.1.1.32  phospholipase A1
     VFMJ11_1652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1758506..1759279)
Genome map
AA seq 257 aa AA seqDB search
MKKWMLLIALVIPSLSFAKELNRIHAYEDSYILGSYISDLNKQTYIDGGFEDADGLHDVE
VKFKFSFAVPLFPVSQSSSIMFAYTQKSLWQLGNSDISSPFRETNYKPQFFLMHQSNMLI
FNNAEFGYMHESNGQTASLSRSWDRIYGALERIDGPVQYGVRAWYVIADEENNADITDYL
GNYDVWASVGNDIGTLSTRFHYNFETDKGGAELGYTLNVNQFVGLYVQAWKGYGETLIDY
NHDQTRIGLGIKLMPPN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatggatgctattaattgcattggtaataccctctttatcgttcgcaaaagag
ttaaatcgtatacacgcctatgaagatagctatattttaggttcttatattagtgatttg
aataaacaaacttacattgatggtggttttgaagatgctgatggtcttcatgatgtcgaa
gtgaagtttaaattttcatttgcagtgcctttgtttccagttagtcaaagttcctcgatc
atgtttgcttatacacaaaagtcattatggcagttaggtaatagcgatatttcatcccct
tttagagaaactaactataaaccacaatttttcttgatgcatcagtcaaatatgttgatt
tttaacaatgctgaatttggttatatgcatgaatctaatggtcaaacagcaagtttatct
cgtagttgggatcgcatttatggcgcattagaacgaattgatggccctgtacaatacggc
gttagagcttggtatgtcattgctgatgaagaaaataatgcggatataacggattattta
ggaaattacgatgtttgggcgtctgttggcaatgatattggtacacttagtactcgtttc
cattataattttgaaacggataaaggtggtgcagagcttggctacacattaaatgttaat
caatttgttggtttatatgttcaagcatggaaagggtatggggaaaccttaattgattat
aatcatgatcaaactcgaattggtcttggtattaaattaatgccgccaaattaa

DBGET integrated database retrieval system