KEGG   Aiivibrio fischeri MJ11: VFMJ11_1671Help
Entry
VFMJ11_1671       CDS       T00754                                 

Definition
(GenBank) ribosomal large subunit pseudouridine synthase F
  KO
K06182  
23S rRNA pseudouridine2604 synthase [EC:5.4.99.21]
Organism
vfm  Aiivibrio fischeri MJ11
Brite
Enzymes [BR:vfm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.21  23S rRNA pseudouridine2604 synthase
     VFMJ11_1671
Ribosome biogenesis [BR:vfm03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    VFMJ11_1671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(1774927..1775871)
Genome map
AA seq 314 aa AA seqDB search
MTSPEPKLTRLNKFISDTGYCSRREADKLIDQQRITINGKIPEMGTKVADGDEVLVDGKP
LKEKQDRIYIAFNKPVGITCTTERHVEGNIVDYINHEQRIFPIGRLDKPSDGLIFLTNDG
DIVNKILRAGNAHEKEYVVRVDKPITDEFLQKMAAGVPILDTVTLPCKIKQESRFVFRIT
LTQGLNRQIRRMCEYLDYEVFKLKRVRIMNIDLGKLASGEWRYLSQAEMDQLNGMIGTSS
KTEEASRKVKEIDGKVRVLKKASSGRNHHSNNTFKENRREKAKEGRFSKSAPKRKNDRKE
QGKPQSEIKVWRPK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaccagaacctaaattaacccgtctgaataaatttattagtgatacgggatat
tgctcacgaagagaagccgataaacttatcgatcaacaacgtattacgattaatggcaag
atccctgaaatgggaacgaaagtagctgatggcgatgaagttttggttgatgggaagccg
ttaaaagagaaacaggaccgcatttatattgcttttaataagcctgttggaattacttgt
acgacagaacgacatgttgaaggtaatattgttgattacattaatcatgagcagcgtatt
tttcctattggtcgattggataaaccgtcggatggtttaatattcttaaccaatgatggc
gatattgtaaataagatcctgcgagcgggtaacgctcatgaaaaagaatatgtggttcgt
gttgataagccgattactgatgaatttttacagaaaatggcagccggtgtaccgatccta
gatacggtgacacttccatgtaagattaagcaagaatctcgctttgtttttcgaattacg
ttaactcaaggcttaaaccgtcaaattcgtagaatgtgtgaatatttagattatgaagta
tttaaattaaaacgtgttcgtattatgaatattgatctaggtaagcttgcttctggagaa
tggcgttatttaagtcaagctgagatggaccagctaaacggaatgattggtacatcaagt
aagacagaagaagcgtctcgcaaagtaaaagaaattgatggtaaggttcgtgtattgaaa
aaagcgagttcaggaagaaatcatcattcaaataatacgtttaaagaaaatcgtcgtgaa
aaagccaaagaagggcgttttagcaaatcggcacctaagcgtaaaaatgatcgtaaagag
caaggtaagccgcaatctgaaataaaagtatggcgaccaaaatag

DBGET integrated database retrieval system