KEGG   Vibrio fischeri MJ11: VFMJ11_1809Help
Entry
VFMJ11_1809       CDS       T00754                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
vfm  Vibrio fischeri MJ11
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vfm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1920298..1920900)
Genome map
AA seq 200 aa AA seqDB search
MRTSGLLEQLMESLRCLPGVGPKSAQRMAFHLLQRNRQGGMQLADALSQAMSEIGHCSEC
RTFTEEDTCAICLNPKRQASGEMCIVESPADIVAVEATGQFSGRYFVLMGHLSPLDGIGP
SDIGLDLLDHRLNRGDIKEVILATNPTVEGEATAHYIAELCQEHQVPASRIAHGVPMGGE
LELVDGTTLSHSILGRQKLY
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaccagtggtttactagaacaattaatggaatcattacgatgcttacctggtgtc
ggtccaaaatcagctcagcgaatggctttccacttgcttcagcgtaatcgccaaggcgga
atgcaattagctgatgcactctctcaagcgatgtcagagattggtcactgctcggaatgt
cgaacatttactgaggaagatacctgcgctatttgtttgaatccaaagcgtcaagcaagt
ggtgaaatgtgtattgttgaaagcccagcagatattgttgcagtagaagcaacagggcag
ttttctgggcgttactttgtactaatgggacatttatcgccactggatggtattggtcca
agcgatattggtttagatttattagatcatcgtctgaatcgtggtgatatcaaggaagtg
attcttgcaactaacccaacggttgagggtgaagcaacggcacactatattgcagagctt
tgccaagagcaccaagtaccagctagtcgaatagcacatggtgtaccaatgggcggtgaa
ttagaattagttgatggtacaacgttatctcactctattttaggtcgtcagaagctttat
tag

DBGET integrated database retrieval system