KEGG   Vibrio fischeri MJ11: VFMJ11_2048Help
Entry
VFMJ11_2048       CDS       T00754                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
vfm  Vibrio fischeri MJ11
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vfm01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:vfm00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2173140..2174273
Genome map
AA seq 377 aa AA seqDB search
MSDTPTLALAKDLLSRQSITPEDAGCQELMIKRLEALGFTIEIMVFEDTTNFWARRGNEA
PLFTFAGHTDVVPTGDLTHWNTNPFEPTIIDGMLYARGAADMKGSLACMVVAVERFVGEH
PNHKGSISFLITSDEEGPFINGTTRVVDTLQERNEIIDMCIVGEPSSTSHVGDVVKNGRR
GSLTGNLTVKGIQGHVAYPHIARNPIHQAMPALSELATTVWDNGNDYFPPTSFQIPNMNG
GTGASNVIPGTVDIMFNFRFSTESTVDELQQRVVEILDKHDLEYDLDWIINGLPFLTDTG
DLLTAVVNAVDTVNQQKPQLLTTGGTSDGRFIAQMGSQVIELGPVNATIHKVNECVNVED
LEKLTDMYQEVLNNLLA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatacaccaacattagctcttgctaaagatttactaagccgccaatccatcaca
cctgaagatgcaggttgccaagagctaatgattaaacgactagaagctcttggttttacc
attgaaattatggtgtttgaagatacaaccaacttttgggctcgtcgaggcaatgaagca
ccattatttacttttgcaggacatacggatgttgttcctacaggtgatttaacgcattgg
aataccaatccatttgaaccaacaatcattgacggaatgctctacgctcgtggagcagca
gatatgaagggctctttagcttgtatggtggttgccgttgagcgtttcgtcggagagcac
ccgaatcacaaaggttcaatttcatttttaatcacatccgatgaagaaggtccatttatt
aatggcacgactcgtgttgtagataccctgcaagaacgtaacgaaatcattgatatgtgt
atcgtaggtgaaccatcaagtacctctcatgttggtgatgtggttaaaaatgggcgtaga
ggatcattaacaggtaatttaaccgttaaaggtattcaagggcatgttgcttatccgcat
atagctcgcaatccaattcaccaagcgatgcccgctctgtcagagctagcaacgaccgtt
tgggacaatggcaatgattattttccaccaacaagctttcaaatcccaaatatgaatggc
ggcacaggcgcttcaaacgttattcctggcacagtcgatatcatgtttaactttagattc
agcaccgaatcaacagtcgatgagctacaacaacgtgtcgtcgaaattttagataaacat
gatttagaatacgacttagactggattatcaatggtctccctttcctaactgatactggc
gatttattaacagccgttgttaatgctgtcgatacggttaatcaacaaaaaccacaacta
ttaacgacgggtggaacgtcagatgggcgttttattgctcaaatgggttcccaagttata
gagcttggcccagttaatgcgaccattcataaggtaaacgagtgcgtaaatgtagaagat
ttagaaaaactgactgatatgtatcaagaagtcctaaataatctactagcataa

DBGET integrated database retrieval system