KEGG   Aiivibrio fischeri MJ11: VFMJ11_2157Help
Entry
VFMJ11_2157       CDS       T00754                                 

Definition
CytC
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
vfm  Aiivibrio fischeri MJ11
Brite
Enzymes [BR:vfm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     VFMJ11_2157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2291669..2293054)
Genome map
AA seq 461 aa AA seqDB search
MKKIGLVVGLGVVAYLGTVYIVDSSDEALSQRKLAQAQIKDDPISSAAFKVLTENGCGYC
HTENSEMPFYANFPIAKQIMQKDVESGLRHFQFDDVLNSFQVGNEVSDVALAKISGVLND
ESMPPKAYLSMHWRSSLSNEEKHTLRTWIKQEQKNKHSLASSEYKYEAVQPINAHVTVDE
QKVALGDVLYHDKRLSGDNTVACSSCHSLSTGGVDRLTTSTGINGSKGPINAPTVFNSSY
NIHQFWDGRANDLQEQAGGPPMNPIEMGSASWEQITGKLELDEEMKATFAKIYPDGITGE
NITDAIAEFEKTLITPNSRFDQFLKGDALALNAQEQHGYELFKQNKCSTCHAGQAMGGQT
FEVMGLKADYFGERGNVSEVDNGRFNVTSKAHDMNRFKVPTLRNIALTAPYFHDGSAETL
DDAVAAMAQYQVGVTLSKSEVEDISAYLKTLTGEYKGEMLN
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataggattagtagttggtttaggcgtcgttgcttatcttggaacggtttac
attgttgattcatcagatgaagcgcttagccaaagaaaattagctcaagcacagattaaa
gatgacccaatctcttctgctgcgtttaaagtattaacagagaacggctgtggttactgc
catactgaaaatagcgaaatgcctttttatgctaactttccaatcgctaaacagatcatg
caaaaagatgtggagagtggactacgtcatttccaatttgatgatgtattaaatagtttt
caagttggtaatgaagtttcagatgttgctttagctaaaatcagtggtgtattgaatgat
gaatcaatgccaccaaaagcgtatttgtctatgcactggagatcaagcttatctaatgaa
gaaaagcatactctacgcacatggataaagcaggaacaaaagaataaacactcattggct
agtagtgaatataaatacgaagcggttcaaccgattaacgcacatgtcactgtagatgaa
caaaaagtggcattaggtgatgtgttataccacgataaacgtctttctggtgataacacg
gtagcttgttctagctgtcattcattatcaacgggcggagtagatagattaactacatca
actggtattaatggttcaaaaggcccaatcaatgcgccgacggtgtttaactcatcttat
aatatccatcagttctgggacggtcgtgcgaatgacttacaagagcaagcgggtggacca
ccgatgaatcctatcgagatgggatctgcatcttgggagcaaattacaggtaagcttgaa
cttgatgaagagatgaaagcgacctttgctaagatttatcctgatgggatcacaggtgaa
aatatcaccgatgcgattgctgagtttgagaaaaccttgatcactccgaatagtcgattt
gaccaattcttaaaaggtgatgcgttagcgttgaatgcgcaagagcaacacggttatgaa
ttatttaaacaaaataaatgttcgacttgtcatgctggtcaagcaatgggtggacaaacg
tttgaagtcatgggcttaaaagcggattactttggtgagcgaggcaatgtatctgaggtg
gataatggtcgttttaatgtgacgagtaaagcacatgatatgaaccgatttaaagttccg
acattacgcaatattgcattaacggcaccgtatttccatgatggtagcgctgagacacta
gatgacgcagttgctgcgatggcgcaataccaagttggtgtgactttatctaaaagtgaa
gttgaagatattagcgcttatttgaaaaccttaactggtgagtacaaaggtgaaatgctg
aattaa

DBGET integrated database retrieval system