KEGG   Aiivibrio fischeri MJ11: VFMJ11_2222Help
Entry
VFMJ11_2222       CDS       T00754                                 

Gene name
thrC
Definition
(GenBank) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VFMJ11_2222 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VFMJ11_2222 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VFMJ11_2222 (thrC)
Enzymes [BR:vfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VFMJ11_2222 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(2359963..2361246)
Genome map
AA seq 427 aa AA seqDB search
MKLYNIKENDEQVSFGQAVRQGLGRNQGLFFPSELLKFDDVDALLAEDFISRSTKILSAF
IKEELPQDTVRSMVENAFQFPAPIKAVKDDVYALELFHGPTLAFKDFGGRFMAQSLGAVT
DSDEQITILTATSGDTGAAVAHAFYGMDNIKVVILYPKGKISPLQEKLFCTLGKNIHTVA
VDGDFDDCQALVKQSFDDAELRKEVGLNSANSINISRLMAQICYYFEAVSQLPKEKRNDV
VISVPSGNFGNLTAGLLAKSLGLPVKRFIAATNVNDTVPRYLETGQWEPKVTIPTISNAM
DVSQPNNWPRIEELCQRLGWGLETLGKGAVTDEQSAETLKEMNQAGYLCEPHGAIAYRIL
NEQLSDGETGLFLCTAHPAKFKEVVEDILGNDIELPAPLAKHNAMELLSEDLDNDFDALK
AVLRKVQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtataacataaaagaaaatgatgagcaggtctcttttggccaagcggttcgc
caaggtttaggtcgcaatcaaggactattttttccatcagaattacttaaatttgatgat
gttgatgcacttcttgctgaggattttatttctcgtagtactaaaattttatctgctttt
atcaaagaggagctgcctcaagataccgtaagaagtatggttgagaatgcatttcaattc
ccagcaccgattaaagccgttaaagatgatgtctatgcgttagaattatttcatggacca
acattagcatttaaggattttggtggccgttttatggctcaatctctaggtgctgtgact
gatagcgatgaacaaatcactattttaacggcaacatcgggtgataccggtgcggctgtt
gctcatgcattttatggtatggacaatattaaggtcgtcattctttacccgaaaggtaaa
atcagtccgctgcaagagaagttattttgtacattaggtaagaatatccataccgttgct
gttgatggtgattttgatgattgccaagcattagtaaaacagtcttttgatgatgcagaa
ctgcgtaaagaagttggattaaattctgcaaactcaatcaatattagccgtttgatggca
caaatttgttactattttgaggcggtatctcaactaccaaaagaaaaacgtaatgatgtc
gttatttcagtgccaagtggtaattttggcaacttgactgcgggattattggcgaaatca
ttaggcttacctgtaaaacgctttattgctgcaacgaatgttaatgataccgttcctcgt
tatcttgaaacgggtcaatgggaacctaaagtcacgatcccaacgatttcaaatgcaatg
gatgtaagtcaaccaaataactggcctcgtattgaagagctatgtcagcgtttaggatgg
ggattagaaactcttggtaaaggtgcagttactgatgagcaaagtgctgaaacattaaaa
gagatgaatcaagctggctatctatgtgagcctcatggtgccattgcttatcgtatattg
aatgagcaactctctgacggtgaaactggccttttcttatgtacagcacatccagctaag
tttaaagaagtagttgaagatatcctaggcaatgatattgagctacctgctccattagct
aagcataatgcgatggaattgttatctgaagatttagataatgattttgatgcacttaaa
gcagtattaagaaaagttcaataa

DBGET integrated database retrieval system