KEGG   Aiivibrio fischeri MJ11: VFMJ11_2282Help
Entry
VFMJ11_2282       CDS       T00754                                 

Gene name
folK_1
Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
vfm00790  Folate biosynthesis
vfm01100  Metabolic pathways
Module
vfm_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VFMJ11_2282 (folK_1)
Enzymes [BR:vfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     VFMJ11_2282 (folK_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK DUF4195
Motif
Other DBs
NCBI-ProteinID: ACH66718
UniProt: B5FB04
Position
I:2448290..2448775
Genome map
AA seq 161 aa AA seqDB search
MIKVIIAIGSNLGDPVAQAKVAINALHQLPDSKVTAVSSLYSSSPMGPQDQPDYINAVVE
IETNLAPMELLDLTQKIELEQGRVRKEERWGPRTLDLDIILFGDQTIDNERLTVPHYGMK
EREFVLYPLAEIYNDLTLPDGTTLSQLLKTVDINGLSIWED
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagtaattattgcgattgggagtaaccttggagatcccgtagctcaagcaaaa
gtggctatcaatgccctgcaccagcttccggactctaaagtaacagcggtatcgtcgctt
tacagcagttcacctatgggccctcaagatcaacctgactacattaacgcagttgttgag
attgaaaccaaccttgctccaatggaattactggatctcactcaaaagattgagcttgag
caaggtcgtgtgcgtaaagaagagcgctggggaccaagaactttagatctcgatattatt
ttatttggcgatcaaacgatcgacaatgagcgattaaccgtgcctcattacggcatgaaa
gaacgtgaatttgttctttatccgctcgctgaaatttataatgatttaactttacctgat
ggcacaaccctctctcagttactaaaaactgtagatataaatggtttgtctatttgggaa
gattaa

DBGET integrated database retrieval system