KEGG   Vibrio fischeri MJ11: VFMJ11_2318Help
Entry
VFMJ11_2318       CDS       T00754                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
vfm  Vibrio fischeri MJ11
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:vfm00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:vfm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2489063..2490544)
Genome map
AA seq 493 aa AA seqDB search
MMQLSELLLSWCELNQSVAISSMTLDSRQVSPGCLFVAIKGHAVDGRQFISSAIEQGAVA
VIADADEDNIAGTVKVINNAIVVYIDSLYTQLSAIAGAFYQADKRCMQLVGITGTNGKTT
ISQIIAQWTTLLDQPAAVMGTTGNGLLSDLKPALNTTGSPIEIQQTLTELENIGAKLTAL
EVSSHGLVQGRVNALSFDAAVFTNLSRDHLDYHGDMENYAEAKKLLFTSHRPKHSIINAD
DQVGCQWLKEMPHAVAVSLNEENISFHSGKKVFATSVVYSTEGIQLSVSSDWGNVAFSVP
LIGAFNASNILVAFATLLSLGYDIQALAQTASQLNAVIGRMELFTADNKAKVVVDYAHTP
DALDKALQALRVHCEGKLWCIFGCGGDRDTGKRPMMASIAEQQADVIILSDDNPRSEEPS
LITNDMLAGLKNSESAHVIHDRFEACQFALSQANENDIILLAGKGHEDYQVLADKTVYYS
DRETAQTLLGLQS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagttatctgaattactgttgtcttggtgcgagttaaatcaatctgtggcaatt
tcatctatgacattggacagtcgccaagtatctcctggctgtttatttgtagcaattaaa
ggccatgcagtagatggtcgccaatttatttcatcagcaattgaacaaggtgctgttgca
gttattgctgacgctgatgaagataatattgcaggaacggtaaaggttatcaataacgct
attgttgtttacattgattctctttatacgcagttaagtgcgattgcaggagctttctat
caagcggataagagatgcatgcaacttgtcggtattactggtactaatggtaaaacgacg
atttctcagatcattgctcaatggacgacattattagatcaacctgctgccgtaatggga
acaacgggtaatggcttactgtcggatcttaagccagccttgaacacaactggtagtcca
attgaaatccaacaaacactgacagagcttgagaatatcggagccaaactgacggcatta
gaagtgtcgtctcatggtttagttcaagggcgtgttaatgcgttatcttttgatgcagca
gtatttactaacttaagccgtgaccatcttgattatcatggtgatatggaaaactatgct
gaagctaaaaagctactttttacttctcataggccaaaacactcaatcatcaatgcggat
gatcaagtgggctgccaatggttaaaagagatgcctcatgccgtcgctgtttctttaaat
gaagaaaacatctcttttcattccggtaagaaggtatttgcaacatcggttgtttattca
accgaaggcattcaactttccgtttcttcagattggggaaatgttgctttttcagtgcct
ttaattggagcatttaacgcgagcaatattctcgttgctttcgcaacacttctttcttta
ggttatgacatccaagctttagctcaaacggcgtctcagctgaatgcagttattggcaga
atggagttgtttactgcagataataaagccaaagtggttgtcgattatgcgcatacgcct
gatgctttagataaagcgttgcaagcattacgagttcattgtgaaggtaagttgtggtgt
attttcggctgtggtggcgatagagatacagggaaacgaccaatgatggcaagcattgct
gagcaacaagcagatgtgattatcttaagtgatgataatcctcgttcagaagaaccaagc
ttaattactaatgatatgctggctggattaaaaaattctgaatctgcacatgttattcat
gatcgctttgaagcttgtcagtttgcattatctcaagcaaatgagaacgatatcatttta
cttgccggtaaagggcatgaagattatcaagtgttagcggataagaccgtttattactct
gatcgtgaaaccgcacaaacattattagggctacaatcatga

DBGET integrated database retrieval system