KEGG   Aiivibrio fischeri MJ11: VFMJ11_2462Help
Entry
VFMJ11_2462       CDS       T00754                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
vfm00010  Glycolysis / Gluconeogenesis
vfm00030  Pentose phosphate pathway
vfm00051  Fructose and mannose metabolism
vfm00052  Galactose metabolism
vfm00680  Methane metabolism
vfm01100  Metabolic pathways
vfm01110  Biosynthesis of secondary metabolites
vfm01120  Microbial metabolism in diverse environments
vfm01130  Biosynthesis of antibiotics
vfm01200  Carbon metabolism
vfm01230  Biosynthesis of amino acids
vfm03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VFMJ11_2462 (pfkA)
   00030 Pentose phosphate pathway
    VFMJ11_2462 (pfkA)
   00051 Fructose and mannose metabolism
    VFMJ11_2462 (pfkA)
   00052 Galactose metabolism
    VFMJ11_2462 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    VFMJ11_2462 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    VFMJ11_2462 (pfkA)
Enzymes [BR:vfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VFMJ11_2462 (pfkA)
Protein phosphatases and associated proteins [BR:vfm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VFMJ11_2462 (pfkA)
Messenger RNA biogenesis [BR:vfm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     VFMJ11_2462 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACH66040
UniProt: B5FBT1
Position
I:complement(2639484..2640446)
Genome map
AA seq 320 aa AA seqDB search
MVKKIGVLTSGGDAPGMNAAVRGVVRTALTEGLEVFGIHDGYLGLVEDRIEKLERHSVSD
MINRGGTFLGSARFPEFKEVAVREKAIENLKKHDIDALIVIGGDGSYMGAKKLTEMGYPC
IGLPGTIDNDIAGTDYTIGYLTALNTVIDAIDRLRDTSSSHQRISIVEVMGRHCGDLTLM
SAIAGGCEYVITPETGLNKEALIQNIQDGIAKGKKHAIIAITELMTDVNQLAKEIEAETG
RETRATVLGHIQRGGQPGAFDRILASRMGNYGVKLLIDGHGGRCVGIQNEQLVHHDIIDA
IENMRRPEKLELYKVAEELF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagaagattggtgttttaacaagtggtggcgatgcgccgggtatgaatgcggca
gttcgtggtgttgttcgtacagcattgacggaaggcctagaagtatttggtattcatgat
ggctacttaggtcttgttgaagatcgtatcgaaaaattagagcgtcacagcgtatctgat
atgatcaaccgcggcggtacattcttaggttcagcacgttttcctgagtttaaagaagta
gctgttcgtgaaaaagcgatcgaaaaccttaagaaacacgacattgatgcgctaatcgtt
atcggtggtgacggttcttacatgggtgcgaagaaattaactgaaatgggttacccatgt
atcggtcttcctggcacaatcgataatgatatcgcgggtactgactacacaattggttac
ctaacagcattaaacactgttattgatgcaattgaccgtctacgtgacacgtcttcttct
caccaacgtatttctattgtagaagttatggggcgtcactgtggtgacttaactcttatg
tctgcaattgctggtggttgtgagtacgttattactcctgaaacaggtttaaacaaagaa
gctctgattcaaaatatccaagatggtattgcgaaaggtaaaaaacacgcaatcatcgcg
atcactgagctgatgactgatgttaaccaacttgcaaaagaaatcgaggctgaaacgggt
cgtgaaactcgcgcaacggttcttggccatattcaacgtggtggtcaacctggtgcattc
gaccgtatcctagcttctcgtatgggtaactatggtgttaaattgctgattgatggacac
ggtggccgttgtgttggtattcaaaatgaacaacttgttcaccacgatatcatcgatgca
attgaaaacatgcgtcgtccagaaaaacttgagctatacaaagtagctgaagagttattc
taa

DBGET integrated database retrieval system