KEGG   Aiivibrio fischeri MJ11: VFMJ11_2462Help
Entry
VFMJ11_2462       CDS       T00754                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VFMJ11_2462 (pfkA)
   01230 Biosynthesis of amino acids
    VFMJ11_2462 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VFMJ11_2462 (pfkA)
   00030 Pentose phosphate pathway
    VFMJ11_2462 (pfkA)
   00051 Fructose and mannose metabolism
    VFMJ11_2462 (pfkA)
   00052 Galactose metabolism
    VFMJ11_2462 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    VFMJ11_2462 (pfkA)
Enzymes [BR:vfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VFMJ11_2462 (pfkA)
Protein phosphatases and associated proteins [BR:vfm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VFMJ11_2462 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2639484..2640446)
Genome map
AA seq 320 aa AA seqDB search
MVKKIGVLTSGGDAPGMNAAVRGVVRTALTEGLEVFGIHDGYLGLVEDRIEKLERHSVSD
MINRGGTFLGSARFPEFKEVAVREKAIENLKKHDIDALIVIGGDGSYMGAKKLTEMGYPC
IGLPGTIDNDIAGTDYTIGYLTALNTVIDAIDRLRDTSSSHQRISIVEVMGRHCGDLTLM
SAIAGGCEYVITPETGLNKEALIQNIQDGIAKGKKHAIIAITELMTDVNQLAKEIEAETG
RETRATVLGHIQRGGQPGAFDRILASRMGNYGVKLLIDGHGGRCVGIQNEQLVHHDIIDA
IENMRRPEKLELYKVAEELF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagaagattggtgttttaacaagtggtggcgatgcgccgggtatgaatgcggca
gttcgtggtgttgttcgtacagcattgacggaaggcctagaagtatttggtattcatgat
ggctacttaggtcttgttgaagatcgtatcgaaaaattagagcgtcacagcgtatctgat
atgatcaaccgcggcggtacattcttaggttcagcacgttttcctgagtttaaagaagta
gctgttcgtgaaaaagcgatcgaaaaccttaagaaacacgacattgatgcgctaatcgtt
atcggtggtgacggttcttacatgggtgcgaagaaattaactgaaatgggttacccatgt
atcggtcttcctggcacaatcgataatgatatcgcgggtactgactacacaattggttac
ctaacagcattaaacactgttattgatgcaattgaccgtctacgtgacacgtcttcttct
caccaacgtatttctattgtagaagttatggggcgtcactgtggtgacttaactcttatg
tctgcaattgctggtggttgtgagtacgttattactcctgaaacaggtttaaacaaagaa
gctctgattcaaaatatccaagatggtattgcgaaaggtaaaaaacacgcaatcatcgcg
atcactgagctgatgactgatgttaaccaacttgcaaaagaaatcgaggctgaaacgggt
cgtgaaactcgcgcaacggttcttggccatattcaacgtggtggtcaacctggtgcattc
gaccgtatcctagcttctcgtatgggtaactatggtgttaaattgctgattgatggacac
ggtggccgttgtgttggtattcaaaatgaacaacttgttcaccacgatatcatcgatgca
attgaaaacatgcgtcgtccagaaaaacttgagctatacaaagtagctgaagagttattc
taa

DBGET integrated database retrieval system