KEGG   Vibrio fischeri MJ11: VFMJ11_2585Help
Entry
VFMJ11_2585       CDS       T00754                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
vfm  Vibrio fischeri MJ11
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:vfm00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2768123..2768941)
Genome map
AA seq 272 aa AA seqDB search
MDSTLSHLIPEVINIARASGQLILDIYEKGDFEEFIKSDETPVTSADLAAHKLIIEKLSQ
LTPDIPILSEEDAGISLEQRAQWERYWLVDPLDGTQEFIARSGDFATIIALVENNRPVMG
VVYGPVSGVTYYAYEGKGAWKIPDMDESVRISTLKHEDEKQPIAIAISRRQDINNITRCM
SSDWNYDLVPLGSAALKACLVAEGAVDCYLRLGPTGEWDTAATQCIVQEAGGRILSTELE
PLSYNERESLENPNFIVLGDENLPWNKILTCK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggattctacactttctcaccttatccctgaggtgatcaatattgcacgtgcatcgggt
caacttattctcgatatatacgagaaaggagatttcgaagagttcattaaatcagatgaa
actccagtgaccagtgccgatcttgccgctcataaattaattatcgaaaaactttctcaa
ttaacaccagatattcctatcctttctgaagaagatgcagggatatctttagagcaacga
gctcaatgggaacgttattggctcgttgaccctcttgatggtacgcaagagttcatcgcg
cgcagtggtgattttgctacgattattgctttagtagaaaataatcgtccggtaatgggg
gttgtgtatggtcctgtttcaggtgttacatactacgcttatgaagggaaaggggcgtgg
aaaattcctgatatggatgaaagtgttcgtattagtacgttaaagcatgaagatgaaaaa
cagccaattgcgatagcgatcagtcgacgtcaagatatcaataacataacacgttgtatg
agctctgattggaattacgatttggttccattggggtcagctgcgcttaaagcctgtttg
gtcgcagaaggtgcagtggattgttatttacgattaggtccaactggtgaatgggatacc
gcagcaacgcagtgtattgttcaagaggcgggaggtcgcatcttatctacagagcttgaa
ccgctgtcttataatgaacgagagtcattagaaaatccgaattttattgttctcggtgac
gaaaatttaccgtggaataaaattcttacatgtaaataa

DBGET integrated database retrieval system