KEGG   Aiivibrio fischeri MJ11: VFMJ11_2604Help
Entry
VFMJ11_2604       CDS       T00754                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VFMJ11_2604
Enzymes [BR:vfm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VFMJ11_2604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2788154..2789122
Genome map
AA seq 322 aa AA seqDB search
MKAATFTQETHYLETMKNQVAPFWEKRQHGFYQGEKETQLHWVSFTSPAHTKAIMVVNGR
IESVYKYQELFYDLFCQGYDIYSFDHRGQGLSDRLTDNNDIGHIEDFNDYVLDLNSLTQS
LITPEHYQDCYLLGHSMGGAIATQYVETHSHPYTALALSAPMHGIHMQPWLKPIANPISR
YLSLWSKQPSYALGQAPYHAKPFLDNALTTCEIRYQWFRELYDTKPELQIGGPSNHWVNQ
GLKGAKLCVDHAAQCTIPTLLLQGEKDQIVDNNAHVKFQKKAPDCQLITISDAKHELLFE
TDECRNQALVAIIDFFQQHAHV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgacctttactcaagaaacgcattaccttgaaactatgaaaaaccaagtg
gcccctttttgggagaaacgccaacacggtttttatcaaggagagaaggaaacacaactt
cattgggtaagttttaccagccctgctcacaccaaagcgatcatggttgttaacggacga
attgaaagtgtctataaataccaagagctgttttatgatttattctgccaaggctatgat
atttattctttcgatcaccgtggccaaggtctgtccgatcgcctaacggataacaatgat
attggtcatattgaagattttaatgattacgttctcgacttaaatagcctaactcaatca
ttaatcacacctgagcattaccaagactgctatctactaggtcattcaatgggaggggca
attgcaactcaatacgttgaaactcactctcatccctacaccgctttagcattaagtgcc
ccaatgcatggtattcatatgcaaccttggctaaaacccattgcaaacccaattagtcgc
tacttaagcttatggtcaaaacagccttcttacgccttaggccaagcaccctatcatgca
aaaccatttttagataatgcgctcactacttgtgaaattcgttatcagtggtttagagaa
ctctatgacaccaaaccagaattgcagatcggtgggccaagtaatcattgggttaatcaa
ggattaaaaggggcaaagctatgtgttgaccacgcagcacaatgcacgattccaacctta
ttacttcaaggcgaaaaagaccaaatcgttgataataatgcgcatgtgaagtttcagaaa
aaagcaccagattgccaattaataaccatttctgatgctaaacatgaattgctgtttgag
acggatgaatgccgcaaccaagcattagttgctatcattgattttttccaacaacacgct
cacgtgtga

DBGET integrated database retrieval system