KEGG   Aiivibrio fischeri MJ11: VFMJ11_A0271Help
Entry
VFMJ11_A0271      CDS       T00754                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    VFMJ11_A0271 (glpK)
Enzymes [BR:vfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     VFMJ11_A0271 (glpK)
Exosome [BR:vfm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VFMJ11_A0271 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:304283..305797
Genome map
AA seq 504 aa AA seqDB search
MTEQKYIVALDQGTTSSRAVILDHDANIVSVSQREFTQIYPEAGWVEHDPLEIYATQSST
LVETLAKAGIRSDQIAGIGITNQRETTIVWNKETGKPVYNAIVWQCRRTADTCEKLKEAG
LEEYIRENTGLVVDPYFSGTKIKWILDNVEGAREDAEAGKLLFGTVDTWLVWKMTQGRVH
VTDYTNASRTMVFNINTLQWDEKLLKELDIPLSMMPEVKSSSEVYGETNIGGKGGTRIPI
AGIAGDQQAALYGQMCVEQGQAKNTYGTGCFLLMNTGKEKVTSRNGLLTTLACGPRGEAS
YALEGAVFMGGASIQWLRDEMKLLADAKDSEYFATKVDTSNGVYVVPAFTGLGAPYWDAY
ARGTIVGLTRGCGSNHIIRATLESIAYQTRDVIDAMQADSGIKLSALRVDGGAVANNFLM
QFQSDVLDVAVHRSKVTEVTALGAAYLAGLAVGFWNGLDELADKAVIDRSFEPHHDEEKR
NQRYRGWKRAVKCAQSWAELHDEE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcaaaaatacattgttgcacttgaccagggtactacgagttctcgtgctgtc
attcttgaccacgatgccaatattgtcagtgtttctcaacgtgaatttactcagatttat
ccagaagctggatgggttgagcatgatccactagaaatctacgcaacacaaagctctaca
cttgttgaaacgttagcaaaagctgggatccgcagcgatcaaattgcaggtataggtatt
accaatcagcgtgaaacaacgattgtttggaataaagaaaccggtaagcctgtttataat
gccattgtttggcaatgtcgccgtaccgctgatacgtgtgaaaaattaaaagaagcagga
ttagaagaatacatccgtgaaaataccggtcttgttgtagacccatacttctctggaacc
aaaattaaatggattctagataatgtagagggagcacgtgaagatgcagaagctggtaag
ttattatttggtactgttgatacatggcttgtgtggaagatgacacaagggcgtgtccac
gtaaccgattataccaatgcatcgcgtactatggtgttcaatatcaatacacttcagtgg
gatgaaaaactactaaaagagttagatataccgctttcaatgatgccagaagttaagtcg
tcatcagaagtttatggtgaaacgaatattggtggtaaaggaggtacgcgtattcctatt
gctggtatcgcaggagatcagcaagctgcgctttatggacaaatgtgtgtagagcaaggc
caagcaaaaaatacctatggcacaggctgcttcttgttgatgaatacaggaaaagaaaaa
gtaacttctcgtaatggtcttttaactacgttagcgtgtggtcctagaggtgaagcatct
tatgctcttgaaggagcagtgtttatgggaggggcttctatccaatggttacgtgatgaa
atgaagttattagcggatgctaaagattcagaatattttgcaaccaaagtagacacatct
aatggtgtttatgttgttccagcttttactggtcttggagctccatattgggatgcttat
gcacgcggtacgattgtgggtttaactcgtggttgtggttctaaccatattattcgtgca
acgcttgaaagtattgcttatcaaactcgtgatgtcattgatgctatgcaggcggattct
ggcattaagttatctgcacttcgtgttgatggtggcgcggtagcgaacaatttcttaatg
caattccagtcagatgtattggatgtggccgtgcatcgttctaaagttactgaagtaacg
gctcttggtgcggcatatctagctggtttagccgttggtttttggaatggtcttgatgag
ttagcagataaagctgtcattgaccgttcgtttgaaccacatcatgatgaagaaaagcgt
aatcaacgttaccgtggttggaaacgcgcagtaaaatgtgcacaatcgtgggcagagttg
catgatgaagagtaa

DBGET integrated database retrieval system