KEGG   Aiivibrio fischeri MJ11: VFMJ11_A0339Help
Entry
VFMJ11_A0339      CDS       T00754                                 

Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
vfm00052  Galactose metabolism
vfm00561  Glycerolipid metabolism
vfm00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VFMJ11_A0339
  Lipid metabolism
   00561 Glycerolipid metabolism
    VFMJ11_A0339
   00600 Sphingolipid metabolism
    VFMJ11_A0339
Enzymes [BR:vfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     VFMJ11_A0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Raffinose_syn GHL6 Melibiase_2
Motif
Other DBs
NCBI-ProteinID: ACH63464
UniProt: B5ET76
Position
II:377175..378914
Genome map
AA seq 579 aa AA seqDB search
MMNPLFFLCGQESIPVQTDLIYEFQNDQISMHFSGIHNLPINDHYLILQFPTQLEHDAKI
LGDGFQMLAQTGGKVDSPQEIGRCPDNSPSYRIYSDRAKKRFYNYLVIEQSDGFTLFGFT
SCYRFAGYFEIHEYQGAMNVMAFLDGEFTHPQDWASNRMESLTVIKADSLAELYELYAAK
VQQQHPIRPGVKQDAPIGWCSWYAYYADVTEKNVLDNVEVMCQKDSEFEWVLLDDGYQAF
MGDWLTPSDKFPNGIKALLQDIKAKGKKPAIWIAPFIAQPESDIFKNHPDWFVHHENGEL
LKAEDITYGGWRCTPWYILDTSKQEVQIHLTEVIHTMKEEWGVELFKLDANYWGTLKGKR
IQSGITGIEAYRLGMQAITNGAGDALVLGCNAPMWPSLGLVDAMRVSDDVERNPQRFEQI
AKETFYRSWQHRKLWQIDPDCVTLISLSNQGTERKYYEFHRNVILASGGLALSGDPLPDL
NKFAKKTWKNILSRLRLTQEAAQFTSLSNKHCTLTLNHQHELHCLFNYDDEAMEHTLVAD
QPSIWRDFWTGEQLNEEPTQMLILTLESGLNSKAILVSN
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacccactatttttcttatgtggacaagaaagtatcccggtacaaaccgattta
atttatgaattccaaaatgatcaaatatcgatgcatttttcaggtattcataatcttcca
attaatgatcattatcttattctgcaatttccaacccaattagagcacgatgcaaaaatt
ttgggtgatggttttcaaatgcttgctcagacaggcggaaaagtcgactcaccacaagag
atcggccgctgtcctgataatagccctagttatcgaatttattcggatcgcgcaaaaaaa
agattttataattatttagtgattgaacaatcagacggatttactctctttggttttact
tcttgttatcgatttgctggttatttcgagatacatgaatatcaaggagcaatgaatgta
atggcatttcttgatggtgaatttactcatccgcaagattgggctagtaatcgaatggag
tcattaacggttattaaggctgactctttagctgagttatatgagctttatgcagccaaa
gtacaacagcagcacccaattcgaccaggagtaaaacaagatgctccaattggctggtgc
tcctggtacgcctactatgcagacgttacagagaaaaatgtcttagataatgttgaggtt
atgtgccaaaaagactctgaatttgagtgggtgcttcttgatgatggatatcaagccttc
atgggagactggttaaccccttcagataaatttcctaatggtatcaaagcgcttttacaa
gatataaaagcgaaaggaaagaaaccggctatttggatagctccatttattgcacagcct
gaatcagacatttttaaaaatcatccagattggtttgttcatcacgaaaatggtgaatta
ttaaaagcggaagatattacttatggcggttggcgttgtacgccttggtatatccttgat
acttcaaaacaagaagttcaaattcatttaacagaggttatccacaccatgaaggaagag
tggggagtagaactgtttaaattggatgctaactactggggaacactaaaaggtaagcga
atacaatctgggattacgggcattgaggcatatcgattaggtatgcaagcgattacaaat
ggggctggtgatgcgttagttcttggctgtaatgcgccaatgtggccatcgttgggttta
gttgatgcaatgcgagtttctgatgatgtcgaacgtaaccctcaacgttttgaacagatt
gcaaaagagacattttaccgtagctggcagcaccgtaaattgtggcaaatcgatcctgat
tgtgtcacgttgatctcattgtctaatcaagggactgaacgaaaatattatgaatttcac
cgaaatgtgattttagcttctggtggacttgcattgtctggtgatccgttaccagatttg
aataagttcgcaaagaaaacatggaagaatattttgtctcgtcttcgtttaactcaagag
gcggctcagtttacttcattgagtaataagcattgcacattaacactcaatcatcagcat
gaattgcattgtctatttaactatgatgatgaagcaatggaacacacccttgttgctgat
cagccatctatttggcgagatttctggacaggggagcagttaaatgaagaacctacccag
atgctaattttaactttagagagtggattgaacagtaaagctattttagtttcaaattaa

DBGET integrated database retrieval system