KEGG   Aiivibrio fischeri MJ11: VFMJ11_A1001Help
Entry
VFMJ11_A1001      CDS       T00754                                 

Definition
(GenBank) endoglucanase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
vfm  Aiivibrio fischeri MJ11
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:complement(1115585..1116763)
Genome map
AA seq 392 aa AA seqDB search
MKMQLTVLSLLIGTLTCSSSAIAQDENYATPIVSSTALTKENQCEWGQWNSFKQHYIENG
RVVDNSDPRSITTSEGQSYALFFALIANDKKTFDELLGWTELHLAGGDLTAQLPAWLWGT
QPDGSQGILDSNSAADSDLWIAYSLLEAGRLWDNHYYQSLGHLLASRILREETIKVSGLG
TVLLPGKVGFVLGKNHVRLNPSYVPLQLLTRMNTVFPNYQWSELYQSSARLLKETMPKGY
SPDWVEWDKTQFKKDSKTQNVGSYNAIRVYLWAGMLPNSDPNKALLLGKMKPLLHAIERN
KGMPETINVLTGKGKNQGGTGMNAAILPLLSSLDSNTNVVEYEKKIQTELPKIESDYYYN
SVLTLFGLGWYQDLYSFNDDGSVTPKWVNVCQ
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgcaattaacggtattgagtctattaattggcacgttaacttgctcttcttca
gctattgctcaagatgaaaattacgcaaccccaatcgtttcatcaaccgcactaacaaaa
gaaaaccagtgtgaatgggggcaatggaatagctttaaacaacattacatagagaatggt
cgagtcgttgataacagtgaccctcgctcaattacgacatcagaaggccaatcttatgct
ctattttttgcattaattgcgaatgataaaaagacatttgatgaattacttggttggact
gagttgcatttagctgggggagacttaacagcacaactccctgcttggttatggggaacg
cagcctgatggttcgcaaggtattttagattcaaactcagcagctgattcggatttatgg
atagcttatagtttgctcgaagcgggaaggttgtgggataaccattattaccaatctctt
gggcacttattggcaagccgaattttacgtgaagagaccatcaaagtgtcaggtcttgga
acggtattattaccgggtaaagtaggatttgtattaggtaaaaaccatgttcgtttaaac
ccaagctacgttccattgcagttactaactcgaatgaatacagttttccctaattaccaa
tggtctgaactgtatcaatcaagtgcaagattactaaaggaaaccatgccaaaaggttat
agtcctgattgggttgagtgggataaaactcaatttaaaaaagattcaaagacccaaaat
gttggcagctataatgcaattagagtgtatttgtgggcaggaatgctaccaaatagtgat
cctaataaagcattgttacttggtaaaatgaaaccattacttcatgctatagaaagaaat
aaaggtatgccggagacaataaatgtattgacaggtaaaggtaaaaatcaaggcggaacc
ggaatgaatgcagctattttacctttattatcttcattagattcaaatacaaatgttgtt
gaatatgagaagaagatccaaacagaattgccgaaaattgaaagtgattattactataat
agtgtgctgactttattcggtcttggttggtatcaagatttgtactcttttaatgatgat
ggtagcgttactcctaagtgggttaatgtatgtcagtaa

DBGET integrated database retrieval system