KEGG   Aiivibrio fischeri MJ11: VFMJ11_A1084Help
Entry
VFMJ11_A1084      CDS       T00754                                 

Definition
(GenBank) 6-phospho-beta-glucosidase AscB
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
vfm00010  Glycolysis / Gluconeogenesis
vfm00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VFMJ11_A1084
   00500 Starch and sucrose metabolism
    VFMJ11_A1084
Enzymes [BR:vfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     VFMJ11_A1084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF3997
Motif
Other DBs
NCBI-ProteinID: ACH64411
UniProt: B5EVB4
Position
II:1203542..1204972
Genome map
AA seq 476 aa AA seqDB search
MSNNVFPKDFLWGGAIAANQAEGAHLEGGKGLTTVDMIPYGENRMATKLGLLENVTLSDS
EYYPSHQAIDFYHRYKDDIALLAQMGFKVFRTSIAWSRIFPKGDEVEPNQEGIRFYKNLF
LECKKHGIEPLVTLCHFDVPMHLVNEYGSWRNRKMISFFERYAKTCFTEFNGLVKYWLTF
NEINILLHSPFSGAGILFKKGENKEQIKYQAAHHELVASALVTRIAHEINPQNQVGCMLA
GGNFYPYSCKPEDVLTAMQKDRENLFFIDVQSRGYYPSYAQKVFNEKNVVIDITDEDREI
LKNTVDFISFSYYASRCASADMNDNNTSEANVVKSIKNPHLEASDWGWVIDPVGLRITMN
TLYDRYQKPLFLVENGLGAVDTIDEHGEINDDYRINYLKEHIKAMKDAISDGVPLMGYTP
WGSIDLVAASTGEMSKRYGFIYVDRDNLGNGTLNRMPKKSFYWYKKVIETNGEELE
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacaatgtattccctaaagactttttatggggtggagccatcgctgccaaccaa
gccgaaggtgctcacctagaaggtggaaaaggattaacaactgtagatatgatcccttac
ggtgaaaatcgtatggcaactaaactggggttacttgagaatgtaacattaagtgactct
gaatattatcctagccatcaagccatcgatttctaccatcgctacaaagacgacatagct
ctacttgctcaaatgggttttaaagtatttagaacatctatcgcatggagccgcattttt
cctaaaggtgatgaagtagagccaaaccaagaaggcattcgcttttataaaaatcttttt
ttagagtgtaaaaaacatggtattgaacctctagttacactatgccactttgatgttcct
atgcatctagtaaacgaatacggttcttggcgaaacagaaagatgatttcattttttgaa
cgctatgcgaaaacctgttttaccgaatttaatggtttagtgaaatattggctcactttt
aacgaaattaatatcttattgcatagccctttctctggtgcaggtattctttttaaaaaa
ggggaaaataaagagcaaataaagtatcaagctgcacaccatgaactagtagcgagtgca
ttagttacacgaatagctcatgaaattaacccacaaaatcaagtcggttgtatgctggct
ggcggtaatttctatccctattcatgtaaacctgaagatgtattaactgcaatgcaaaaa
gacagggagaacctattttttattgatgttcaatctcgtggttattatccatcttatgct
caaaaagtattcaatgagaaaaatgtagttattgatattactgatgaagatcgtgaaatt
ttaaaaaatactgtcgatttcatctcattcagttattacgcatctcgttgcgcatctgca
gatatgaacgataacaacacaagcgaggcgaatgttgttaaatcgattaaaaatcctcac
ttagaagccagtgattggggatgggttattgatcccgttggtttacgtatcacgatgaac
accttgtacgatcgttatcaaaaaccgctattcttagtcgaaaatggattaggagccgtc
gatacgattgatgagcatggcgagataaatgatgattaccgtatcaattaccttaaagaa
catattaaagcaatgaaagatgcgatttcagatggtgttccactaatgggttatacacca
tggggaagcattgatttagttgctgcatcaactggggaaatgagtaaacgctacgggttt
atctatgtcgatcgagacaacttaggtaatggtactttaaatagaatgccgaaaaaatca
ttttactggtataaaaaagtcattgaaactaatggcgaagagctagaataa

DBGET integrated database retrieval system