KEGG   Aiivibrio fischeri MJ11: VFMJ11_A1128Help
Entry
VFMJ11_A1128      CDS       T00754                                 

Definition
chitobiase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VFMJ11_A1128
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VFMJ11_A1128
Enzymes [BR:vfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VFMJ11_A1128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1254042..1256687)
Genome map
AA seq 881 aa AA seqDB search
MFKKTLLSTLILAGLAGCSSTSSEQSAVNQLAENLDINYTVITNQGADDGLACKELQAEW
ASCNKVNMTLTNTGEAVDSKDWTIYFHSIRLILDVENDQFKITRVTGDLHKLEPTEKFDG
FAAGEEVVIPLIAEYWQLFETDFMPGAFVTAPGAEARNIISLDTEDTGEYVDEIIGVQLK
RTLADNNVVATANTRFEKNADVVEENVASHIIPTPLKTTLTNKTVDLAKGISITANGIDA
DQLAALNQRAELLGLETAGEYPVSVSVDKKQFKGGVSGAYKLDVTEGKATVVAFDQAGAF
YGVQSLLALVSLDNSEIPTLNVEDAPRFEYRGVMVDVARNFHSKEAILATVDQMAAYKLN
KLHLHLTDDEGWRLEIPGLPELTDIGGNRCFDETETSCLLPQLGSGADSDNFGSGYFTTE
DYLEILTYAKNRNIEVIPEIDMPAHSRAAVMSMEARYARLAAEGKMEEANQYRLMDPKDE
SNVTTVQFYNKQSFINPCLDSSATFVDKVITEVAAMHKAAGVPLSTWHFGGDEAKNIKLH
AGFQDINDEEKIAWKGDLDLSKQDFPFAKSPQCQSLIASGEVADFEHLPSHFAEQVSKIV
AKQGIPHFQAWQDGLKHSEDADAFATESVRANFWDTLYWGGGASAYEWAEKGYDIVISNP
DYVYMDFPYEVDAKERGYYWATRATDTRKMFGFAPENLPQNAETSVDRDGNGFESAGTVT
PKKPFYGLSAQLWSETVRTDEQYEYMVFPRVIAAAERAWHEASWENEYKAGVKYSLQTNL
VDKKAQLADWTKFANTMGQRELAKLERAGIDYRLPIPGAEIANGELSMNISFPGVTLQYS
VDGGKTWAEYDNANKPKVTGDVQIRSASFTGERVSRVTSVK
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagaaaacgcttttatcaaccctaattcttgctggtctagcaggctgttcatca
acatcatctgagcagtcagcggttaatcaactagctgaaaatctagatattaactacaca
gttattacaaaccaaggagctgatgacggtcttgcatgtaaagagcttcaagctgaatgg
gcatcatgtaacaaagtaaacatgacgctgactaacactggtgaagctgttgattcaaaa
gattggacaatttatttccacagcatccgtttaattttagatgttgaaaacgaccaattt
aaaattactcgcgtaacgggtgatttacataaacttgaaccaactgaaaagtttgatggt
tttgcagcaggtgaagaagtagttattccactgatcgctgaatactggcaattatttgaa
actgactttatgccaggtgcatttgtaacggctccaggtgcagaagctcgtaatatcatt
tctttagatacagaagatacaggtgaatacgtagatgaaatcatcggtgttcagctaaaa
cgtactcttgctgataataacgttgttgcaacagcaaacactcgttttgagaaaaacgca
gatgtagttgaagagaatgtggcttctcacattattccaacaccattaaaaacaacacta
acgaacaaaacggtagatttagctaaaggtatctctattactgcaaacggaattgatgct
gaccaacttgctgcgttaaatcaacgtgcagaactacttggccttgaaactgcaggtgag
tacccagtatcagtttctgttgataagaaacaatttaaaggcggtgtatctggtgcatac
aagctagatgtaactgaaggtaaagcaacggttgtagcatttgaccaagcgggtgcattc
tacggcgtacaatctttacttgctctagtaagtttagataactcagaaatcccaacgtta
aacgtagaagatgctccacgttttgaataccgtggtgtaatggttgatgtagctcgtaac
ttccattcaaaagaagcaattctagcgactgttgatcaaatggcggcatacaagctaaac
aaactacaccttcacttaactgatgatgaaggttggcgtttagagatccctggtcttcct
gagctaacggatattggtggtaatcgttgttttgatgagacagaaacctcttgtctgcta
cctcagttaggttctggtgctgattcagataactttgggtctggttacttcacaacagaa
gattatctagaaatcttaacttacgcgaaaaaccgtaacattgaagtgattccagaaatc
gatatgccagctcactcacgtgcagcagttatgtcaatggaagcgcgttacgcacgtctt
gctgctgaaggtaagatggaagaagcgaaccaataccgtctgatggatccaaaagatgaa
tcaaacgtaactacggttcagttctacaacaaacaaagttttatcaacccatgtctagat
tcatctgcaacgtttgtagataaagtaatcacagaagttgcagcaatgcataaagcagca
ggtgttcctctatcaacatggcacttcggtggtgatgaagcgaaaaacatcaaacttcac
gctggtttccaagacatcaacgatgaagagaaaattgcatggaaaggggatttagaccta
tctaaacaagatttcccatttgctaaatcgccacagtgccagtctctgatcgcaagcggt
gaagttgctgatttcgaacatttaccaagccacttcgcagagcaagtatctaagatcgtt
gctaagcaaggtatcccacacttccaagcatggcaagatggtctaaaacactctgaagat
gcagatgcattcgcaacggaatcagtacgtgctaacttctgggatacattgtactggggc
ggtggtgcttcagcttacgaatgggctgagaaaggttatgacatagttatctctaaccca
gattacgtttacatggacttcccatacgaagtggatgcaaaagagcgtggttactactgg
gcaacacgtgcaacggacactcgtaagatgtttggttttgcaccagaaaacctacctcaa
aatgcggaaacatcagtagaccgtgacggtaatggctttgaaagtgcgggtacagtaaca
cctaagaaacctttctacggtctatctgctcaactttggtctgaaacagtacgtactgat
gagcaatatgaatacatggtgttcccacgtgttattgcagcggctgagcgtgcatggcat
gaagcatcttgggaaaatgaatacaaagcaggtgttaagtactctctacaaacaaaccta
gtagataagaaagcacaattagctgattggactaagtttgcaaatacaatgggccaacgt
gaattagctaagcttgaaagagcgggcattgattaccgtctaccaatcccaggtgcagaa
attgcgaacggtgagctaagcatgaacatttcattcccaggtgtaacgttacaatactct
gtagatggcggtaaaacatgggctgaatacgacaatgcaaacaaaccaaaagtaactggt
gacgttcaaattcgttcagcatcatttactggtgagcgtgttagccgtgtaactagcgtt
aagtaa

DBGET integrated database retrieval system