KEGG   Aiivibrio fischeri MJ11: VFMJ11_A1165Help
Entry
VFMJ11_A1165      CDS       T00754                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    VFMJ11_A1165
Enzymes [BR:vfm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VFMJ11_A1165
   3.1.2  Thioester hydrolases
    3.1.2.-  
     VFMJ11_A1165
Lipid biosynthesis proteins [BR:vfm01004]
 Fatty acid synthase
  Component type
   VFMJ11_A1165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1299644..1300258
Genome map
AA seq 204 aa AA seqDB search
MRKLLTLTLILISSQFLAVKIAYSQTLLILGDSLSAGYNMPIEQSWPSLLPEQLNALGKP
TTVINGSISGDTTGNGLDRLPNLLEQHKPNYVLIELGANDGLRGFPPQKINANLEEIFAQ
IKANNAQPLLMQIQVPPNYGKRYSQAFGSLYPKLSEKHAIPLLPFFLEQVIVKPEWMMKD
GLHPKPEAQPWIAEFMAKELQPYL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaattactgactcttactctgatacttattagcagccaatttcttgctgtaaaa
atcgcttatagccaaaccttactgattcttggtgacagcttaagtgcgggatataacatg
ccaatagaacaaagttggccttcattattaccagagcaacttaatgctttaggtaagcca
accacggttataaatggcagtatttcaggtgatacaactggcaatggattagatcgatta
cctaatctattagagcaacataaacctaattatgtgcttattgagttaggtgcaaatgac
ggactacgtggatttccaccacaaaaaatcaatgccaatttagaagagatattcgctcaa
attaaggcaaataatgcacaaccattattgatgcaaattcaagtaccacctaactatgga
aaacgatatagccaagcgtttggatcactgtatccaaaattaagtgagaagcacgccatc
cccctattaccttttttcttagaacaagtaatagtaaaaccagaatggatgatgaaagat
ggattacatccaaagcctgaagctcaaccttggatagcggagtttatggcaaaagagcta
caaccctatttataa

DBGET integrated database retrieval system