KEGG   Vibrio fischeri MJ11: VFMJ11_A1165Help
Entry
VFMJ11_A1165      CDS       T00754                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vfm  Vibrio fischeri MJ11
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:vfm01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1299644..1300258
Genome map
AA seq 204 aa AA seqDB search
MRKLLTLTLILISSQFLAVKIAYSQTLLILGDSLSAGYNMPIEQSWPSLLPEQLNALGKP
TTVINGSISGDTTGNGLDRLPNLLEQHKPNYVLIELGANDGLRGFPPQKINANLEEIFAQ
IKANNAQPLLMQIQVPPNYGKRYSQAFGSLYPKLSEKHAIPLLPFFLEQVIVKPEWMMKD
GLHPKPEAQPWIAEFMAKELQPYL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaattactgactcttactctgatacttattagcagccaatttcttgctgtaaaa
atcgcttatagccaaaccttactgattcttggtgacagcttaagtgcgggatataacatg
ccaatagaacaaagttggccttcattattaccagagcaacttaatgctttaggtaagcca
accacggttataaatggcagtatttcaggtgatacaactggcaatggattagatcgatta
cctaatctattagagcaacataaacctaattatgtgcttattgagttaggtgcaaatgac
ggactacgtggatttccaccacaaaaaatcaatgccaatttagaagagatattcgctcaa
attaaggcaaataatgcacaaccattattgatgcaaattcaagtaccacctaactatgga
aaacgatatagccaagcgtttggatcactgtatccaaaattaagtgagaagcacgccatc
cccctattaccttttttcttagaacaagtaatagtaaaaccagaatggatgatgaaagat
ggattacatccaaagcctgaagctcaaccttggatagcggagtttatggcaaaagagcta
caaccctatttataa

DBGET integrated database retrieval system