KEGG   Vibrio furnissii: vfu_A00303Help
Entry
vfu_A00303        CDS       T01680                                 

Definition
glycyl-tRNA synthetase subunit alpha
Orthology
K01878  
glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
vfu  Vibrio furnissii
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:vfu00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:329815..330783
Genome map
AA seq 322 aa AA seqDB search
MIVIFYQFRQKNRANLTMQKYDIKTFQGMILALQDYWAQQGCTIVQPLDMEVGAGTSHPM
TCLRALGPEPIATAYVQPSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLK
VLGVDPQVHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEI
TYGIERLAMYIQGVDSVYDLVWTDGPLGKVTYGDIYHQNEVEQSTYNFEHADVDFLFTFF
DQCEKECLHLLALEKPLPLPAYERILKAGHAFNLLDARKAISVTERQRYILRIRNLTKSV
AEAYYASREALGFPMCKKSEEK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgttattttttatcaattcagacagaagaatcgcgcgaacctgactatgcaaaaa
tacgatatcaaaacctttcagggtatgatcctcgcgctgcaggattattgggcccaacaa
ggctgtaccattgttcaaccattagatatggaagtgggcgcaggtacgtctcacccaatg
acgtgcttacgagctcttggcccagagccaatcgctacagcgtatgttcaaccttcacgc
cgtccaacagatggtcgttacggtgaaaacccgaaccgtctgcaacactactaccaattc
caggtcatcattaaaccgtcaccagacaacattcaagagctgtacctcggttctctgaaa
gtgctgggcgttgacccacaagtgcacgacatccgcttcgtggaagataactgggaaaac
ccaacactcggtgcttggggtctgggctgggaagtgtggctaaacggcatggaagtgacg
cagttcacttacttccagcaagtgggtggtcttgagtgtaagcctgttaccggcgaaatc
acgtacggtatcgagcgtctagcgatgtacattcagggcgtagattctgtgtatgatttg
gtatggaccgatggcccactaggtaaagtgacctacggtgacatctaccaccaaaacgaa
gtcgaacagtccacgtacaacttcgaacacgccgatgtcgacttcctgttcaccttcttc
gaccaatgcgaaaaagagtgtctccacctgttagcactggaaaaaccactgccattgcca
gcatacgagcgcattctgaaagccggacacgcgttcaacctgctggatgcacgcaaagcg
atttccgtcacggaacgtcaacgctacatcctgcgtattcgtaacctgacgaagtcagtg
gctgaagcttattacgcatcccgtgaagcactgggcttcccaatgtgcaaaaagtccgaa
gagaagtaa

DBGET integrated database retrieval system