KEGG   Vibrio furnissii: vfu_A00448Help
Entry
vfu_A00448        CDS       T01680                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
vfu  Vibrio furnissii
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:vfu00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(473077..474057)
Genome map
AA seq 326 aa AA seqDB search
MTSPYTQESNFEQAIQHQIADLWRTRDEGVYRAFDKTQLYWCSLTKPEHRKAIVVVNGRI
ESAWKYQELFYDLFQQGYDIYAYDHRGQGLSDRLIDEREMGYVGEFHDYVQDLAGLLDMW
DLSRYPQRFLLGHSMGGAIATRLVQTHPQHGFHAMALSAPMFGVHMAWQLRPVALPLSQM
LTAIYHKPTYAPGYSAYYPKPFEINPLTHSEVRYRWFRDLYEAKPELKLGGPSTRWVWQG
LMGAKQCILLTRQVRLPTLVIQAEADTIVSNQAQTRFVTKLARTNPHSTIEVVLGARHEL
LFEQDQYRNQALDAILNHFARASEAK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaccttatactcaagagtccaactttgagcaagcaatccagcatcagattgcc
gatttgtggcgcacgcgtgatgaaggggtttatcgtgcgttcgacaagacccaactctat
tggtgctcattaaccaagccggaacaccgcaaagccattgtggtggtcaacggtcgcatc
gaatccgcttggaagtatcaagaactgttttacgatctgtttcaacaaggatacgacatt
tatgcctacgaccatcgcggtcagggcttgtctgaccgcttgattgacgaacgagaaatg
ggttatgtcggcgaatttcacgattacgttcaagacctcgccggcttgctcgacatgtgg
gatctcagccgctatccacagcgttttcttttgggccattcgatgggcggcgcgatcgcc
acccgcttggtgcaaacccatccgcaacatgggtttcacgccatggcgctcagcgcaccg
atgtttggcgtgcacatggcgtggcaactgcgtccggtggcgctaccgctgtcacaaatg
ctcacggccatttaccacaaaccgacttacgcgccgggctacagcgcgtattatcccaag
ccgtttgaaatcaacccgctcacccacagcgaagtgcgctaccgctggttccgcgaccta
tacgaagccaaaccagaactgaaactgggcggccccagcacacgctgggtgtggcaaggc
ttgatgggcgccaaacagtgcattttgctgacgcgtcaagtgcggctgcccactttggtg
attcaggccgaagccgacaccatcgtcagcaaccaagcgcaaacccgatttgtgaccaaa
ctggcacgcaccaacccgcacagtacgatcgaggtggtgctgggcgcgcggcatgaactg
ctgtttgaacaagatcagtatcgcaatcaagcgctggacgccatcctcaaccactttgcg
cgcgccagcgaggctaaatag

DBGET integrated database retrieval system