KEGG   Vibrio furnissii: vfu_A00546Help
Entry
vfu_A00546        CDS       T01680                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
vfu  Vibrio furnissii
Pathway
vfu00230  Purine metabolism
vfu01100  Metabolic pathways
Module
vfu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    vfu_A00546
Enzymes [BR:vfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     vfu_A00546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 RsgA_GTPase AAA_18 ABC_tran AAA_22 CPT MMR_HSR1 AAA_28 AAA_29 cobW
Motif
Other DBs
NCBI-ProteinID: ADT85758
UniProt: F0LRH2
Position
1:complement(568277..568900)
Genome map
AA seq 207 aa AA seqDB search
MGKGTLYIVSAPSGAGKSSLIAALLERNPTYAMKVSVSHTTRGMRPGEQDGVHYHFVQKE
HFEDLIGKGEFLEYAEVFGNYYGTSRVWIEDTLNKGIDVFLDIDWQGARQIREQMPASKS
IFILPPSKEELERRLNTRGQDSEAVIAKRMSEAQSEISHYSEYDYVIINDDFDVALMDFK
AIMRAERLKQDKQAAKYSSMLAALLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaggtactctatacatcgtctctgcaccaagtggcgcaggcaaatcgagcttg
atcgcggcgctgttggaacgcaatccaacgtacgcgatgaaagtgtccgtttcgcacacc
acgcgcggcatgcgcccgggcgaacaagacggcgtgcactatcacttcgttcagaaggag
cacttcgaagacttgattggcaaaggcgagtttttggagtacgccgaagtgttcggaaac
tactacggcacatcccgtgtctggattgaggacacgctaaataaaggtattgatgtcttt
ttggacattgactggcaaggtgcgcgtcaaatccgcgaacagatgccagcatcaaaaagc
atctttattctgccgccatccaaagaagagctggagcgtcgtttaaacacgcgcggccag
gatagcgaagcagtgattgcaaaacggatgagtgaagcgcagtcagaaatttcgcactac
agcgaatacgactacgtgatcatcaacgacgatttcgatgtcgcactgatggattttaaa
gccatcatgcgtgcagaaagattgaagcaggataagcaagctgctaaatatagcagtatg
ctggctgcacttctggcggactaa

DBGET integrated database retrieval system