KEGG   Vibrio furnissii: vfu_A00576Help
Entry
vfu_A00576        CDS       T01680                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vfu  Vibrio furnissii
Pathway
vfu00010  Glycolysis / Gluconeogenesis
vfu00030  Pentose phosphate pathway
vfu00051  Fructose and mannose metabolism
vfu00052  Galactose metabolism
vfu00680  Methane metabolism
vfu01100  Metabolic pathways
vfu01110  Biosynthesis of secondary metabolites
vfu01120  Microbial metabolism in diverse environments
vfu01130  Biosynthesis of antibiotics
vfu01200  Carbon metabolism
vfu01230  Biosynthesis of amino acids
vfu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    vfu_A00576
   00030 Pentose phosphate pathway
    vfu_A00576
   00051 Fructose and mannose metabolism
    vfu_A00576
   00052 Galactose metabolism
    vfu_A00576
  Energy metabolism
   00680 Methane metabolism
    vfu_A00576
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    vfu_A00576
Enzymes [BR:vfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     vfu_A00576
Protein phosphatases and associated proteins [BR:vfu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     vfu_A00576
Messenger RNA biogenesis [BR:vfu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     vfu_A00576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ADT85784
UniProt: F0LRS8
Position
1:601266..602228
Genome map
AA seq 320 aa AA seqDB search
MIKKIGILTSGGDAPGMNAAIRGVVRTALGAGLEVFGIYDGYQGLYEGRIKQLDRSSVSD
VINRGGTFLGSARFPQFREEAVREKAIENLKTHGIDALVVIGGDGSYMGAKKLTEMGYPC
IGLPGTIDNDIAGTDYTIGYLTALNTVIEAIDRLRDTSSSHQRISIVEIMGRHCGDLTLM
SAIAGGCEYIITPETGLDMEQLISNIQDGIKKGKKHAIIALTELMMDANQLAKEIEKATG
RETRATILGHIQRGGKPTAFDRVLASRMGNYAVHLLMEGHGGRCVGIQKEQLVHHDIIDA
IENMKRPVRKDLFQVAEELF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaagatcggtattttgacaagtggcggcgacgccccaggcatgaatgctgcg
attcgcggcgtggttcgtacggcgttgggcgcaggtcttgaagtattcggcatctacgat
ggctatcaaggcctgtacgaaggtcgtatcaagcagctagaccgttcaagcgtgtctgat
gtgattaaccgtggtggtacattcttgggctctgcgcgtttcccgcagttccgtgaagaa
gcagtgcgtgaaaaagcgatcgaaaacctgaaaacacacggcatcgatgcattggttgtg
atcggtggtgacggttcgtacatgggtgcgaagaaactgactgaaatgggttacccatgt
atcggtctgccaggtaccatcgacaacgacatcgcgggcacggattacaccatcggttac
ctgactgcactgaacaccgtgatcgaagcgattgaccgtctgcgtgacacgtcttcttct
caccaacgtatttcgatcgttgaaatcatgggtcgtcactgcggtgacttgacgctgatg
tctgcgatcgcaggcggctgtgagtacatcatcacgcctgaaacgggtttggatatggaa
cagctgatttctaatattcaagacggcatcaagaaaggtaagaaacacgcgatcatcgcg
ctgactgaactgatgatggatgcgaaccaattggcgaaagagatcgaaaaagcgacgggt
cgtgagactcgtgcgacgatcctaggccacattcaacggggtggtaaaccaactgcgttt
gaccgcgtgcttgcgtctcgcatgggtaactacgccgttcatctattgatggaaggtcac
ggtggtcgttgtgtgggcattcaaaaagagcaactggttcaccacgacatcatcgatgcg
attgaaaacatgaaacgtccagtacgtaaagatctgttccaggtggctgaagagttgttc
taa

DBGET integrated database retrieval system