KEGG   Vibrio furnissii: vfu_A00576Help
Entry
vfu_A00576        CDS       T01680                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vfu  Vibrio furnissii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    vfu_A00576
   01230 Biosynthesis of amino acids
    vfu_A00576
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    vfu_A00576
   00030 Pentose phosphate pathway
    vfu_A00576
   00051 Fructose and mannose metabolism
    vfu_A00576
   00052 Galactose metabolism
    vfu_A00576
  Energy metabolism
   00680 Methane metabolism
    vfu_A00576
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    vfu_A00576
Enzymes [BR:vfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     vfu_A00576
Protein phosphatases and associated proteins [BR:vfu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     vfu_A00576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:601266..602228
Genome map
AA seq 320 aa AA seqDB search
MIKKIGILTSGGDAPGMNAAIRGVVRTALGAGLEVFGIYDGYQGLYEGRIKQLDRSSVSD
VINRGGTFLGSARFPQFREEAVREKAIENLKTHGIDALVVIGGDGSYMGAKKLTEMGYPC
IGLPGTIDNDIAGTDYTIGYLTALNTVIEAIDRLRDTSSSHQRISIVEIMGRHCGDLTLM
SAIAGGCEYIITPETGLDMEQLISNIQDGIKKGKKHAIIALTELMMDANQLAKEIEKATG
RETRATILGHIQRGGKPTAFDRVLASRMGNYAVHLLMEGHGGRCVGIQKEQLVHHDIIDA
IENMKRPVRKDLFQVAEELF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaagatcggtattttgacaagtggcggcgacgccccaggcatgaatgctgcg
attcgcggcgtggttcgtacggcgttgggcgcaggtcttgaagtattcggcatctacgat
ggctatcaaggcctgtacgaaggtcgtatcaagcagctagaccgttcaagcgtgtctgat
gtgattaaccgtggtggtacattcttgggctctgcgcgtttcccgcagttccgtgaagaa
gcagtgcgtgaaaaagcgatcgaaaacctgaaaacacacggcatcgatgcattggttgtg
atcggtggtgacggttcgtacatgggtgcgaagaaactgactgaaatgggttacccatgt
atcggtctgccaggtaccatcgacaacgacatcgcgggcacggattacaccatcggttac
ctgactgcactgaacaccgtgatcgaagcgattgaccgtctgcgtgacacgtcttcttct
caccaacgtatttcgatcgttgaaatcatgggtcgtcactgcggtgacttgacgctgatg
tctgcgatcgcaggcggctgtgagtacatcatcacgcctgaaacgggtttggatatggaa
cagctgatttctaatattcaagacggcatcaagaaaggtaagaaacacgcgatcatcgcg
ctgactgaactgatgatggatgcgaaccaattggcgaaagagatcgaaaaagcgacgggt
cgtgagactcgtgcgacgatcctaggccacattcaacggggtggtaaaccaactgcgttt
gaccgcgtgcttgcgtctcgcatgggtaactacgccgttcatctattgatggaaggtcac
ggtggtcgttgtgtgggcattcaaaaagagcaactggttcaccacgacatcatcgatgcg
attgaaaacatgaaacgtccagtacgtaaagatctgttccaggtggctgaagagttgttc
taa

DBGET integrated database retrieval system