KEGG   Vibrio furnissii: vfu_A00596Help
Entry
vfu_A00596        CDS       T01680                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vfu  Vibrio furnissii
Pathway
vfu00010  Glycolysis / Gluconeogenesis
vfu00051  Fructose and mannose metabolism
vfu00562  Inositol phosphate metabolism
vfu01100  Metabolic pathways
vfu01110  Biosynthesis of secondary metabolites
vfu01120  Microbial metabolism in diverse environments
vfu01130  Biosynthesis of antibiotics
vfu01200  Carbon metabolism
vfu01230  Biosynthesis of amino acids
Module
vfu_M00002  Glycolysis, core module involving three-carbon compounds
vfu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    vfu_A00596
   00051 Fructose and mannose metabolism
    vfu_A00596
   00562 Inositol phosphate metabolism
    vfu_A00596
Enzymes [BR:vfu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     vfu_A00596
Exosome [BR:vfu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   vfu_A00596
  Exosomal proteins of bladder cancer cells
   vfu_A00596
  Exosomal proteins of melanoma cells
   vfu_A00596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3612
Motif
Other DBs
NCBI-ProteinID: ADT85803
UniProt: F0LRU7
Position
1:complement(620777..621547)
Genome map
AA seq 256 aa AA seqDB search
MRRPVVMGNWKLNGSKAMVTELLTGLNAELEGVTGVDVAVAPPALYLDLAERLIAEGGKK
MILGAQNTDLHNSGAYTGDMSPAMLKDFGATHIIIGHSERREYHNESDEFVAQKFAFLKE
NGLTPVFCIGETEAQNEAGETEAVCARQINAVIDAYGVDALNGAIIAYEPIWAIGTGKAA
TAEDAQRIHASIRALIAAKDEAVAAQVIIQYGGSVKPENAEAYFSQPDIDGALVGGASLD
AKSFAAIAKAAAKAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtcctgtagtgatggggaactggaaactgaatggcagcaaagcaatggtaact
gagctgttgactggtctgaatgcggaacttgaaggtgtaacgggtgttgacgtggcagta
gctccaccagcactgtacctggatctggctgagcgtctgattgcagaaggcggcaaaaaa
atgatcctgggtgcacaaaacactgacctgcacaacagcggtgcgtacactggcgacatg
tctccagccatgctgaaagatttcggtgcaactcacatcatcatcggccactctgagcgt
cgtgaataccacaacgaatcagacgagtttgttgctcaaaaattcgcattcctgaaagaa
aacggtctgactccagtattctgtatcggtgaaactgaagcgcaaaacgaagcgggcgaa
actgaagccgtttgtgcacgtcaaatcaacgcagtgatcgatgcatacggcgtagacgct
ctgaacggcgcaatcatcgcttacgaaccaatctgggcaatcggtactggtaaagcagca
acggctgaagatgcacaacgcatccacgcatctattcgcgcgctgatcgcagcgaaagat
gaagcggttgcagcacaagtgatcatccaatacggcggttctgttaaaccagaaaacgca
gaagcttacttctcacaaccagacatcgacggcgctcttgttggcggcgcatctctggat
gcgaaaagcttcgcagccatcgcgaaagcagctgcaaaagcaaaagcgtaa

DBGET integrated database retrieval system