KEGG   Vibrio furnissii: vfu_A00746Help
Entry
vfu_A00746        CDS       T01680                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
vfu  Vibrio furnissii
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    vfu_A00746
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    vfu_A00746
Enzymes [BR:vfu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     vfu_A00746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:755435..756700
Genome map
AA seq 421 aa AA seqDB search
MDKFRVIGSDKPLQGEVTISGAKNAALPILFASILASEPVEVANVPHLRDIDTTMELLKR
LGAKVERNGSVHVDPSQIDQFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGA
RPVDLHINGLEQLGATITLEDGYVKASVDGRLQGAHIVMDKVSVGATITIMCAATLAEGT
TVLDNAAREPEIVDTAMFLNKLGAKISGAGTDTITVEGVERLGGGKHSVVADRIETGTFL
VAAAVSHGKIVCRKTNAKLLEAVLAKLEEAGALIEVGDDWISLDMTGRELKAVSIRTAPH
PGFPTDMQAQFTLLNMMAKGGGVITETIFENRFMHVPELMRMGAKAEIEGNTVICGDVDS
LSGAQVMATDLRASASLVIAGCIAKGETIVDRIYHIDRGYEKIEDKLSALGANIERVRES
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggataagtttcgagttattgggtctgataaaccgctgcaaggcgaagtgaccatttct
ggtgcaaaaaatgctgcactgcctattttatttgcttctattctggcgtctgagccggta
gaagttgccaacgttcctcacttacgtgacatcgacaccaccatggagctgctgaagcgt
ctgggtgcgaaagtcgagcgtaacggttctgtccacgtcgatccaagccaaattgatcag
ttttgtgcgccttatgatttggtgaaaaccatgcgtgcgtccatctgggcattaggtcct
ctcgtggcgcgttttggtcaaggccaagtttcattgccgggcggctgtgcgattggtgct
cgtccggtggatttacacatcaacggtctggagcaactgggcgcgacgatcacattggaa
gacggctacgtgaaagcgagcgtcgatggccgcctacaaggtgcgcacattgtgatggat
aaagtcagcgtgggtgccaccattactattatgtgtgcggccacactggcagaaggcacc
acggtgctggacaacgccgcgcgtgaacctgaaattgtggataccgcgatgttcctcaat
aaactgggcgcgaaaatcagcggtgctggcaccgacaccattacggtggaaggggttgag
cgtctgggcggcggcaaacattctgtggttgcagatcgcattgagaccgggaccttcttg
gtggctgctgcggtatctcacggtaagatcgtgtgccgtaaaaccaacgcaaaactgttg
gaagcggtgctggcgaagctggaagaagcgggtgcattgattgaagtcggcgacgactgg
atcagccttgacatgaccggccgtgaactcaaagcggtctcgattcgtaccgcgccacac
ccaggtttcccaaccgacatgcaagcgcaatttaccttgctgaacatgatggccaaaggt
ggcggtgtgatcaccgaaaccatttttgaaaaccgtttcatgcatgtgcctgaactgatg
cgcatgggagccaaagcggaaatcgaaggcaacaccgtgatttgcggtgatgtcgattct
ctgagtggtgctcaggtgatggccacagatctgcgcgcttcggcgagtttggtgattgca
ggctgcattgccaaaggcgaaaccatcgtggatcggatttatcacatcgaccgtggttac
gagaagattgaagacaagttgtcggctctgggcgcaaacattgagcgcgttcgcgagtcg
agttaa

DBGET integrated database retrieval system