KEGG   Vibrio furnissii: vfu_A00877Help
Entry
vfu_A00877        CDS       T01680                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vfu  Vibrio furnissii
Brite
Enzymes [BR:vfu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     vfu_A00877
Secretion system [BR:vfu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   vfu_A00877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:895357..896121
Genome map
AA seq 254 aa AA seqDB search
MKILRRLSLLLLPFVAVACNAETVSAEKTAAQVQLDKSVFQQRFAKLGLDVMDVVPSAID
GLVEVQTAGGVLFASPDGKHFIAGTLYEMDANGGYTDVLAKRQAPINAKKIAQFQDSMIE
YKAANEKYIVTVFTDITCGYCVRLHSQLKEYNDAGITVRYLAYPRQGPTGQVAEQMASIW
CADDPKAAIHNAKMNRQTLETQGDLAQCKQTIAQHYQLGRELGISGTPAIFLPNGEMVGG
YLPAPQLLQRLQNM
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttacgccgattatcacttctgctgctgccgttcgttgcggtggcgtgtaac
gcagaaacggtgtctgccgagaaaaccgctgcccaagtgcagctcgacaaaagcgtattt
cagcaacgatttgccaagctggggttggatgtgatggatgtggtgccgtcggcgattgac
ggcttggtggaagtgcaaacggccggtggcgtgttgtttgcgtcacccgatggcaagcac
ttcattgctggcacactgtacgaaatggatgccaatggcggctacaccgacgttttggcc
aagcgccaagcgccgatcaatgccaagaaaatcgcgcagttccaagacagtatgatcgaa
tacaaagcggcgaatgaaaaatacattgtcaccgtgtttaccgatattacttgtggctac
tgcgtgcgcctgcacagccagttgaaagagtacaacgatgcgggcattaccgtgcgttat
ctggcgtacccacgccaagggccgaccggtcaagtggcagaacagatggcttccatctgg
tgcgctgatgatccgaaagcggccatccacaacgccaaaatgaaccgtcaaacgttggaa
acccaaggggatttggcgcagtgcaaacaaaccatcgcacagcattaccaattggggcgt
gagctgggcatcagcggcactccggcaatcttcctgccgaacggcgaaatggtcggtggt
tacttgccagcaccacaactgttgcaacgcctacaaaacatgtaa

DBGET integrated database retrieval system