KEGG   Vibrio furnissii: vfu_A01056Help
Entry
vfu_A01056        CDS       T01680                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
vfu  Vibrio furnissii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    vfu_A01056
  Amino acid metabolism
   00330 Arginine and proline metabolism
    vfu_A01056
Enzymes [BR:vfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     vfu_A01056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1103144..1104301
Genome map
AA seq 385 aa AA seqDB search
MFFITEEIMKTNHQSGNVSQTVIVKLGTSVLTGGTLALDRAHMVELARQCAELKKQGHSV
VIVSSGAIAAGREHLGYPALPNAISSKQLLAAVGQSQLIQAWESLFSIYGIKIGQILLTR
ADLDDRERFLNARDTINALVAHDIIPIVNENDAVATNEIKVGDNDNLSALVGILCGADKL
LLLTDQKGLFTADPRKDPNAELIKEVKTIDDTLRKIAGGSGTTLGTGGMATKLQAADIAR
RAGIEVIIAAGRAPNVIFDSLSDAPQGTRFLPLEEALENRKRWILAGPAASGDIFIDDGA
VRAVLNKGSSLLAKGVVRVQGEFSRGEVVRVTNGHGHLVARGIAKYSSRDMAKIAGKHSK
MIIETLGYDYGSEVIHRDDMVVIQE
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcattacagaagaaatcatgaaaacgaatcatcaaagcggaaatgtttcacaa
actgtcatcgtgaaactaggaaccagtgttctgaccggtggtacgttggcgctcgaccgt
gcgcatatggtcgaattggcgcgtcaatgtgctgaactgaaaaaacaaggtcactcagtc
gtgatcgtgtcgtctggtgcaattgcagcaggccgtgaacatcttggttaccccgcactg
cccaacgcgatctcaagcaaacagttgttggccgcggtgggacagagtcagttgattcaa
gcttgggaatctctattttcgatttatggcatcaaaatcggccagattctgctgacgcgt
gccgatcttgacgaccgtgaacgtttcctcaacgctcgtgacaccatcaacgcgttggtg
gctcacgacatcattccgatcgtcaacgaaaacgatgcggtggcgaccaacgaaatcaaa
gtgggcgataacgacaacctgtcagcgttggtcggtattttgtgcggcgccgataaattg
ctgctgctgactgaccaaaaagggctgttcaccgccgacccgcgcaaagaccccaatgcc
gagctgatcaaagaagtcaaaaccattgacgacacgctgcgtaaaatcgcaggtggcagt
ggcaccaccttgggcactggcggtatggcgaccaaactgcaagcggcagatattgctcgc
cgtgcgggcattgaggtgatcattgcggctggtcgtgcgccgaacgtcattttcgattcc
ctgagcgacgcgccgcaaggtacgcgcttcctaccgttggaagaagcgctcgaaaaccgc
aaacgctggattttggctgggccagctgcatccggtgacatcttcatcgatgatggcgca
gtgcgcgcagttttgaacaaaggcagcagcctgctggcgaaaggtgtagtgcgcgttcaa
ggtgaattctcgcgtggcgaagtggtacgggtgaccaacggccatggtcatttggtggcg
cgtggcatcgcgaaatactccagccgcgacatggcaaaaattgccggcaaacacagtaaa
atgattatcgaaacactcggctatgattatggctcagaagtgattcaccgcgacgacatg
gtcgtgattcaggaatag

DBGET integrated database retrieval system