KEGG   Vibrio furnissii: vfu_A01075Help
Entry
vfu_A01075        CDS       T01680                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
vfu  Vibrio furnissii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    vfu_A01075
Enzymes [BR:vfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     vfu_A01075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1121265..1122473
Genome map
AA seq 402 aa AA seqDB search
MRKLTILGATGSIGASTLKVVAENPEQFTVVALAAGGNVDKMRELCARWLPKYAVMATSD
AALRLADELRALKLPTEVLYGEEAMCQVAACDEVDTVMAAIVGAAGLLPTMAAVKAGKRV
LLANKEALVMSGQLFIDAVEQYGAELMPVDSEHNAIFQCLPAEIQTRLGRCDLKQGGISH
ILLTGSGGPFRYSDINTLKDVTPEQAIAHPNWSMGPKISVDSATMMNKGLEFIEAKWLFN
AAPEQLKVLIHPQSVIHSMVQYLDGSVIAQLGEQDMATPISLTMAYPQRVVSGVKALDFT
RLSELTFLEVDYARYPCLKLAIDACYEGQHATTSLNAANEIAVQAFLRGQIRFTDIATIN
ERVLSNVCGTNSPLHSYTLESLIELDTMARSLASQELKERLL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaattaacgattctgggagcgacaggttcaattggagccagtacgcttaaagta
gttgcagagaatcctgaacaatttactgtggtcgcgctcgcggcaggtggcaatgtagat
aaaatgcgcgagctgtgcgctcgctggctcccgaaatatgcggtcatggccacgtcagac
gccgcattgcgtttagccgacgaactgcgcgccctcaaattgccaaccgaagtgctgtat
ggcgaagaggccatgtgccaagtggcagcgtgtgatgaggtcgataccgtgatggcggcg
atcgttggtgcggcgggtttattgccgaccatggcggcggtgaaagcaggcaagcgtgtg
ctgctggcgaataaagaagccttggtgatgtctggccaactgtttatcgatgccgtggaa
cagtacggcgcagaactgatgccggttgatagcgaacacaatgcaattttccaatgcctg
ccggcggagattcaaacccgtctggggcgctgcgatctcaagcaaggcggcatttctcac
attctattgactggctcgggtggtccgttccgttacagtgacatcaacacactcaaagac
gtgacgcctgaacaggccattgcccacccgaactggtcgatggggccaaaaatttcagtc
gattcggcgacgatgatgaataaaggcctcgagtttatcgaagccaagtggctgtttaat
gccgcgccagagcaattgaaagtgctgattcatccgcagtcggtgattcactccatggtg
cagtatttggatggctcggtgattgctcaactgggtgagcaagacatggcgacgccgatt
tcgctcaccatggcttacccgcagcgtgtggtgtctggtgtgaaagcgcttgattttacg
cgcttgagtgagttgaccttccttgaggtggattacgcgcgctatccgtgcttgaagttg
gccattgatgcctgctacgaagggcagcatgcgaccacatccttgaatgcggcgaatgaa
atcgcggtacaagcctttttgcgtggtcagattcgctttactgacattgcaaccatcaat
gaacgcgtgttgtctaacgtgtgtgggacaaatagtccgttacattcctataccttggaa
agcctgattgagctcgatacaatggcgcgtagtttggcatctcaagagttgaaagagcga
ttgttatga

DBGET integrated database retrieval system