KEGG   Vibrio furnissii: vfu_A01165Help
Entry
vfu_A01165        CDS       T01680                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
vfu  Vibrio furnissii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    vfu_A01165
  Amino acid metabolism
   00300 Lysine biosynthesis
    vfu_A01165
Enzymes [BR:vfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     vfu_A01165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1215434..1216570)
Genome map
AA seq 378 aa AA seqDB search
MTDSPVLALAKDLISRQSVTPVDAGCQDLMIERLQALGFEIEMMVFEDTTNFWARRGTQA
PLFAFAGHTDVVPAGPLTQWHTPPFEPTVIDDHLHGRGAADMKGSLACMVVAVERFIAEY
PNHTGSIAFLITSDEEGPFINGTTRVVDTLMARNEIIDMCVVGEPSSTRAVGDVVKNGRR
GSITGDLTVKGVQGHVAYPHLANNPVHQALPALAELASTTWDEGNEYFPPTSFQIPNLQA
GTGASNVIPGEFNVQFNFRFSTELTDEDIKRRVHSTLDAHGLEYDLKWTLSGHPFLTDTG
ALLDAVVKAVGEVNHQEPQLLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVNIAD
LEKLTDMYQKTLENLLVQ
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgacagacagccctgtactggctctcgcaaaagatttaatcagccgccaatcagtgaca
ccggtcgatgccggttgccaagacttgatgattgagcgtctccaagcgcttggatttgaa
atcgaaatgatggtgtttgaagacaccaccaacttctgggcgcgtcgtggcacgcaagcg
ccgctgtttgcgtttgccggtcataccgatgtggtgcctgcaggcccgctcacccaatgg
cacacccccccgtttgaaccgacggtgattgatgaccatttgcatggtcgcggcgcggcc
gacatgaaaggctcgctggcgtgtatggtggttgcggtagaacgctttattgccgagtat
ccgaaccacacgggctcgattgcctttttgattacttccgatgaggaaggcccatttatc
aacggcaccacacgcgtggtggacacgctgatggcacgcaatgagatcatcgacatgtgt
gtggtcggcgaaccgtccagcactcgcgcagtcggcgatgtggtgaaaaatggccgtcgc
ggctccatcaccggtgatttgacggtgaaaggcgtgcaaggtcacgtggcttacccgcat
ctcgccaacaaccctgtgcatcaagccctgcctgcattggctgaacttgcgtccaccaca
tgggatgaaggcaacgaatattttccgccaaccagttttcagatcccgaacctgcaagct
ggcacgggcgcgtctaacgtaattccaggcgagttcaacgtgcagtttaacttccgtttt
agcaccgagctgaccgatgaagacatcaaacgccgcgtgcactccacgctggatgcgcat
ggtctggaatacgatctgaaatggacgctcagcggccatcctttcctcaccgacactggc
gcgctgctcgatgcggtggtgaaagccgtgggtgaagtgaatcaccaagagccacaactg
ctgaccaccggcggcacatctgacgggcgctttatcgcgcaaatgggagcgcaagtggtt
gagctggggccggtcaacgccaccattcacaaagtgaacgagtgcgtgaatattgccgac
ctagaaaaactgaccgacatgtaccaaaaaacgctggagaatttactcgtccaatga

DBGET integrated database retrieval system