KEGG   Vibrio furnissii: vfu_A01231Help
Entry
vfu_A01231        CDS       T01680                                 

Definition
(GenBank) Succinate dehydrogenase, hydrophobic anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
vfu  Vibrio furnissii
Pathway
vfu00020  Citrate cycle (TCA cycle)
vfu00190  Oxidative phosphorylation
vfu00650  Butanoate metabolism
vfu01100  Metabolic pathways
vfu01110  Biosynthesis of secondary metabolites
vfu01120  Microbial metabolism in diverse environments
vfu01130  Biosynthesis of antibiotics
vfu01200  Carbon metabolism
Module
vfu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vfu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vfu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    vfu_A01231
   00650 Butanoate metabolism
    vfu_A01231
  Energy metabolism
   00190 Oxidative phosphorylation
    vfu_A01231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADT86416
UniProt: F0LNK2
Position
1:1276559..1276852
Genome map
AA seq 97 aa AA seqDB search
MIRASAIIMTLYTIYIVSFCAFTDISYVSWTQFFGGTFTKVFTMLALVCILIHGWIGLWQ
VLTDYVKCSKLRGGLQLVVIAVLFGYFFSGLFVLWGA
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
ttgattcgcgccagtgcgatcatcatgacgctttacaccatttatattgttagcttctgt
gctttcactgatatttcttatgtctcttggactcaattctttggtggtaccttcaccaaa
gtcttcacaatgttggcgttagtttgcatcctgattcatggctggattggcctatggcag
gtactgactgactacgtgaagtgttcaaaactgcgtggcggacttcagctcgtcgtaatc
gcagtgctgttcggatactttttctctggcctatttgtattgtggggtgcgtaa

DBGET integrated database retrieval system