KEGG   Vibrio furnissii: vfu_A01231Help
Entry
vfu_A01231        CDS       T01680                                 

Definition
Succinate dehydrogenase, hydrophobic anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
vfu  Vibrio furnissii
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    vfu_A01231
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    vfu_A01231
   00650 Butanoate metabolism
    vfu_A01231
  Energy metabolism
   00190 Oxidative phosphorylation
    vfu_A01231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1276559..1276852
Genome map
AA seq 97 aa AA seqDB search
MIRASAIIMTLYTIYIVSFCAFTDISYVSWTQFFGGTFTKVFTMLALVCILIHGWIGLWQ
VLTDYVKCSKLRGGLQLVVIAVLFGYFFSGLFVLWGA
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
ttgattcgcgccagtgcgatcatcatgacgctttacaccatttatattgttagcttctgt
gctttcactgatatttcttatgtctcttggactcaattctttggtggtaccttcaccaaa
gtcttcacaatgttggcgttagtttgcatcctgattcatggctggattggcctatggcag
gtactgactgactacgtgaagtgttcaaaactgcgtggcggacttcagctcgtcgtaatc
gcagtgctgttcggatactttttctctggcctatttgtattgtggggtgcgtaa

DBGET integrated database retrieval system