KEGG   Vibrio furnissii: vfu_A01235Help
Entry
vfu_A01235        CDS       T01680                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vfu  Vibrio furnissii
Pathway
vfu00020  Citrate cycle (TCA cycle)
vfu00310  Lysine degradation
vfu01100  Metabolic pathways
vfu01110  Biosynthesis of secondary metabolites
vfu01120  Microbial metabolism in diverse environments
vfu01130  Biosynthesis of antibiotics
vfu01200  Carbon metabolism
Module
vfu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vfu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    vfu_A01235
  Amino acid metabolism
   00310 Lysine degradation
    vfu_A01235
Enzymes [BR:vfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     vfu_A01235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3
Motif
Other DBs
NCBI-ProteinID: ADT86420
UniProt: F0LNK6
Position
1:1282269..1283477
Genome map
AA seq 402 aa AA seqDB search
MTVEILVPDLPESVADATVATWHKQPGDVVARDEVIVEIETDKVVLEVPAPEEGVLEAIL
EEEGATVLSKQLLARLKPGAVAGEPTTDTTSATASSPDKRHKATLTEETNDALSPAVRRL
LAEHNLQAEQVKGTGVGGRITREDIEAYLAADKSAPAAAQDVAAPAPIAARSEKRVPMTR
LRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYQDVFEKKHGIRLGFMSFYVKAVT
EALKRYPEVNASIDGSDIVYHNFFDISIAVSTPRGLVTPVLKDSDTLGMAQIEKGIKDLA
IKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQAAILGMHKIQDRAMVVDGKIE
ILPMMYLALSYDHRLIDGRESVGFLVTVKELLEDPTRLLLDV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgaaattctggttccagatttacctgaatcagtagcagacgcaaccgtagcg
acatggcataaacaaccaggtgacgttgttgcacgtgacgaagtaatcgttgaaatcgaa
accgacaaagtggtgttggaagtgccagcaccagaagaaggtgtgttggaagcgattctg
gaagaagaaggcgccactgtactgtcgaaacagttgctagcgcgtctgaaaccgggtgcg
gttgcgggtgaaccaacaaccgataccacgagtgcgactgcatcttctccagacaaacgc
cacaaagcgacgctgactgaagaaacaaacgacgcgctcagcccagccgttcgccgctta
ctggcagaacataatctgcaagcggaacaagtgaaaggcacgggtgttggtggccgtatt
acgcgtgaagacatcgaagcgtacctcgctgcggataaatcagcgccagcggcagcccaa
gacgttgctgcaccagcaccgattgcagctcgcagcgaaaaacgcgtcccgatgactcgc
ctgcgtaagcgtgtggcagagcgtctgctggaagcgaaaaacagcacagcaatgctgaca
acgtttaacgaagtcaacatgaagccaatcatggatctgcgtaagcagtaccaagacgtg
tttgagaagaaacacggcatccgccttggctttatgtcgttctacgtgaaagcggtgacg
gaagcgctgaaacgttatccagaagtgaacgcttccatcgatggcagcgacatcgtatac
cacaacttctttgatatcagcatcgcggtgtctacaccacgcggtctggtgacacccgtc
ctgaaagattccgatacgctgggcatggctcagatcgaaaaaggcatcaaggatctggcg
atcaaaggtcgtgacggtaagctgacagttgaagagctgaccggtggtaacttcactatc
acgaatggcggtgtgtttggctcgctgatgtcgacgccaatcatcaacccaccacaagca
gcgattcttggcatgcacaagattcaggaccgcgcaatggttgttgatggcaagattgaa
atcctgccaatgatgtaccttgctctgtcttacgaccaccgtttgattgatggtcgtgag
tcagttggcttcctggtgacagtgaaagaactgcttgaagatccaacacgtctactgcta
gacgtgtaa

DBGET integrated database retrieval system