KEGG   Vibrio furnissii: vfu_A01235Help
Entry
vfu_A01235        CDS       T01680                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vfu  Vibrio furnissii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:vfu01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:vfu00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:vfu00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1282269..1283477
Genome map
AA seq 402 aa AA seqDB search
MTVEILVPDLPESVADATVATWHKQPGDVVARDEVIVEIETDKVVLEVPAPEEGVLEAIL
EEEGATVLSKQLLARLKPGAVAGEPTTDTTSATASSPDKRHKATLTEETNDALSPAVRRL
LAEHNLQAEQVKGTGVGGRITREDIEAYLAADKSAPAAAQDVAAPAPIAARSEKRVPMTR
LRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYQDVFEKKHGIRLGFMSFYVKAVT
EALKRYPEVNASIDGSDIVYHNFFDISIAVSTPRGLVTPVLKDSDTLGMAQIEKGIKDLA
IKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQAAILGMHKIQDRAMVVDGKIE
ILPMMYLALSYDHRLIDGRESVGFLVTVKELLEDPTRLLLDV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgaaattctggttccagatttacctgaatcagtagcagacgcaaccgtagcg
acatggcataaacaaccaggtgacgttgttgcacgtgacgaagtaatcgttgaaatcgaa
accgacaaagtggtgttggaagtgccagcaccagaagaaggtgtgttggaagcgattctg
gaagaagaaggcgccactgtactgtcgaaacagttgctagcgcgtctgaaaccgggtgcg
gttgcgggtgaaccaacaaccgataccacgagtgcgactgcatcttctccagacaaacgc
cacaaagcgacgctgactgaagaaacaaacgacgcgctcagcccagccgttcgccgctta
ctggcagaacataatctgcaagcggaacaagtgaaaggcacgggtgttggtggccgtatt
acgcgtgaagacatcgaagcgtacctcgctgcggataaatcagcgccagcggcagcccaa
gacgttgctgcaccagcaccgattgcagctcgcagcgaaaaacgcgtcccgatgactcgc
ctgcgtaagcgtgtggcagagcgtctgctggaagcgaaaaacagcacagcaatgctgaca
acgtttaacgaagtcaacatgaagccaatcatggatctgcgtaagcagtaccaagacgtg
tttgagaagaaacacggcatccgccttggctttatgtcgttctacgtgaaagcggtgacg
gaagcgctgaaacgttatccagaagtgaacgcttccatcgatggcagcgacatcgtatac
cacaacttctttgatatcagcatcgcggtgtctacaccacgcggtctggtgacacccgtc
ctgaaagattccgatacgctgggcatggctcagatcgaaaaaggcatcaaggatctggcg
atcaaaggtcgtgacggtaagctgacagttgaagagctgaccggtggtaacttcactatc
acgaatggcggtgtgtttggctcgctgatgtcgacgccaatcatcaacccaccacaagca
gcgattcttggcatgcacaagattcaggaccgcgcaatggttgttgatggcaagattgaa
atcctgccaatgatgtaccttgctctgtcttacgaccaccgtttgattgatggtcgtgag
tcagttggcttcctggtgacagtgaaagaactgcttgaagatccaacacgtctactgcta
gacgtgtaa

DBGET integrated database retrieval system