KEGG   Vibrio furnissii: vfu_A01236Help
Entry
vfu_A01236        CDS       T01680                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vfu  Vibrio furnissii
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    vfu_A01236
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    vfu_A01236
   00640 Propanoate metabolism
    vfu_A01236
   00660 C5-Branched dibasic acid metabolism
    vfu_A01236
Enzymes [BR:vfu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     vfu_A01236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1283645..1284811
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEFGLPVPEGYACDTPQEAFEAAGRISTAKKVVKCQVHAGGRGKAGGV
ELHDTKEGVKEFAQKWLGKNLVTYQTDANGQPVTKILVEEASNIANELYLGAVVDRATRR
IVFMASTEGGVEIEKVAEETPELIHKAAIDPLVGPQAYQGRELAFKLGLQGDQIKQFVKI
FMGLGQMFAQYDLALLEINPLVVTGEGNLLCLDGKINIDSNALYRQPKLREMHDPSQEDA
REAHAAQWELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVTVPVVVRLEGTNADLGRDV
LAKSGLDIIAAESLTDAAQKVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaataccaagccaaacagctgtttgcagaattcggtttgcctgtacca
gaaggctacgcatgtgatacgccacaagaagcgttcgaagcagctggtcgcatcagcacc
gcgaagaaagttgtcaaatgtcaggttcacgctggtggccgcggtaaagcgggcggtgta
gaactgcacgacaccaaagaaggcgtcaaagaattcgcacaaaagtggctgggtaaaaac
ctagtgacttaccaaacggatgcaaatggtcaaccagtgacaaaaatcttggttgaagaa
gcatcaaatatcgctaacgaactgtacctaggtgcggtcgttgaccgtgcaacacgtcgt
atcgttttcatggcatccactgaaggtggcgtggaaattgagaaagtggcggaagaaaca
ccagaactgattcacaaagcagcgatcgatccattggtgggccctcaggcataccaaggc
cgtgagctggcattcaaactgggcctgcaaggtgaccagatcaaacagttcgtgaaaatt
tttatgggtctgggccaaatgtttgctcaatacgacctggctctgctagaaatcaacccg
ctggttgtgactggcgaaggcaacttgttgtgcctagacggcaaaatcaacatcgactca
aacgcgttgtaccgtcagcctaaactgcgcgaaatgcacgatccttcgcaagaagatgcg
cgtgaagcacacgcagctcagtgggaactgaactacgttgcacttgatggcaacgtgggt
tgtatggtcaatggtgctggtctggcgatgggtacgatggacatcgtgaacctacacggt
ggcaagcccgcaaacttcctcgatgttggtggcggcgcaacaaaagagcgcgttgcagaa
gcattcaagatcatcctgtctgatgacaatgtgaaagcggtattggttaacatcttcggt
gggattgtacgttgtgacatgatcgcagaaggtatcatcggcgcagtgaaagaagtcggt
gtcacggtacctgttgttgttcgtcttgaaggtactaacgctgacctcggtcgtgacgta
ctggctaagtcaggtttggatatcattgcagctgagtcgctcactgacgcagctcagaaa
gttgttgctgctgcggagggcaaataa

DBGET integrated database retrieval system