KEGG   Vibrio furnissii: vfu_A02223Help
Entry
vfu_A02223        CDS       T01680                                 

Definition
(GenBank) intracellular septation protein A
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vfu  Vibrio furnissii
Pathway
vfu00260  Glycine, serine and threonine metabolism
vfu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vfu01100  Metabolic pathways
vfu01110  Biosynthesis of secondary metabolites
vfu01130  Biosynthesis of antibiotics
vfu01230  Biosynthesis of amino acids
Module
vfu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    vfu_A02223
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    vfu_A02223
Enzymes [BR:vfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     vfu_A02223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA HMGL-like His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADT87361
UniProt: F0LNY8
Position
1:2323210..2324016
Genome map
AA seq 268 aa AA seqDB search
MDRYQSLFQRLADNNQGAFVPFVTMGDPNPEQSLRIMQTLVEAGADALELGIPFSDPLAD
GPTIQGANLRALNSKTTPDVCFELIGQIRAQYPDLPIGLLMYANLVYSRGVENFYQRCQQ
AGVDSVLVADVPTNESEEFVAAARKFGIKPIFIAPPTASDETMKAVAELGGGYTYLLSRA
GVTGTETKANMPVHAQLDKLTQYNAPPSLLGFGISEPAQVKEAIASGAAGAISGSAVVKI
IESNLDNFDEMLNKLAQFTQNMKAATHK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaccgctatcaatcgctttttcagcgtctggctgacaacaaccaaggtgccttcgtg
ccattcgtcaccatgggcgatccaaaccctgagcagtctctgcgcatcatgcagacgttg
gtggaggctggcgccgatgcactggaacttggcattccgttctcggatccattggctgac
ggaccaaccattcaaggggcgaacctgcgtgcgctgaattcaaaaacgacgcctgacgtc
tgcttcgagttgatcggccagattcgcgcgcaatatcctgatttgccgatcggtttgctg
atgtacgccaacttggtttactcacgcggcgtcgaaaacttctaccaacgctgccaacag
gcgggtgtcgattccgtgctggttgccgatgtcccaaccaacgaaagtgaagaattcgtg
gctgcggcacgtaaatttggcatcaagcctatcttcatcgccccgccaaccgccagcgat
gaaacgatgaaagccgtggccgaactaggtgggggttacacgtacctgctctcacgtgcg
ggcgtaaccggcactgaaacgaaagccaacatgcccgttcacgcgcagctcgacaagctg
acgcaatacaatgcgccgccctcactgctgggttttgggatctctgaaccagcgcaagtg
aaggaagccatcgcatcgggtgcagcgggggcaatttctggctctgccgtcgtcaaaatc
atcgaatccaacctcgataactttgacgaaatgttaaataaactcgctcaattcacgcaa
aacatgaaagcagccacccacaaataa

DBGET integrated database retrieval system