KEGG   Vibrio furnissii: vfu_A02223Help
Entry
vfu_A02223        CDS       T01680                                 

Definition
(GenBank) intracellular septation protein A
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vfu  Vibrio furnissii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    vfu_A02223
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    vfu_A02223
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    vfu_A02223
Enzymes [BR:vfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     vfu_A02223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:2323210..2324016
Genome map
AA seq 268 aa AA seqDB search
MDRYQSLFQRLADNNQGAFVPFVTMGDPNPEQSLRIMQTLVEAGADALELGIPFSDPLAD
GPTIQGANLRALNSKTTPDVCFELIGQIRAQYPDLPIGLLMYANLVYSRGVENFYQRCQQ
AGVDSVLVADVPTNESEEFVAAARKFGIKPIFIAPPTASDETMKAVAELGGGYTYLLSRA
GVTGTETKANMPVHAQLDKLTQYNAPPSLLGFGISEPAQVKEAIASGAAGAISGSAVVKI
IESNLDNFDEMLNKLAQFTQNMKAATHK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaccgctatcaatcgctttttcagcgtctggctgacaacaaccaaggtgccttcgtg
ccattcgtcaccatgggcgatccaaaccctgagcagtctctgcgcatcatgcagacgttg
gtggaggctggcgccgatgcactggaacttggcattccgttctcggatccattggctgac
ggaccaaccattcaaggggcgaacctgcgtgcgctgaattcaaaaacgacgcctgacgtc
tgcttcgagttgatcggccagattcgcgcgcaatatcctgatttgccgatcggtttgctg
atgtacgccaacttggtttactcacgcggcgtcgaaaacttctaccaacgctgccaacag
gcgggtgtcgattccgtgctggttgccgatgtcccaaccaacgaaagtgaagaattcgtg
gctgcggcacgtaaatttggcatcaagcctatcttcatcgccccgccaaccgccagcgat
gaaacgatgaaagccgtggccgaactaggtgggggttacacgtacctgctctcacgtgcg
ggcgtaaccggcactgaaacgaaagccaacatgcccgttcacgcgcagctcgacaagctg
acgcaatacaatgcgccgccctcactgctgggttttgggatctctgaaccagcgcaagtg
aaggaagccatcgcatcgggtgcagcgggggcaatttctggctctgccgtcgtcaaaatc
atcgaatccaacctcgataactttgacgaaatgttaaataaactcgctcaattcacgcaa
aacatgaaagcagccacccacaaataa

DBGET integrated database retrieval system