KEGG   Vibrio furnissii: vfu_A02543Help
Entry
vfu_A02543        CDS       T01680                                 

Definition
Recombinational DNA repair protein
Orthology
K06187  
recombination protein RecR
Organism
vfu  Vibrio furnissii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    vfu_A02543
DNA repair and recombination proteins [BR:vfu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      vfu_A02543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2633948..2634532)
Genome map
AA seq 194 aa AA seqDB search
MLEHLMEALRCLPGVGPKSAQRMAFHLLQRDRKGGLQLADALSQAMVEIGHCSECRTFTE
EEVCHICQNPKRQENGQLCVVESPADIAAVEATGQYSGRYFVLMGHLSPLDGIGPSDIGL
DVLDFRLQRGGISEVILATNPTVEGEATAHYIAELCREHDVSASRIAHGVPVGGELELVD
GTTLSHSLLGRQKL
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgctggagcatttgatggaggccttacgttgtctgcctggggttggccccaagtcagcg
cagcgtatggcctttcatttgttgcaacgagaccgcaaaggtggcttgcaactggcagat
gctctgagtcaggcgatggtggaaatcggccattgcagcgaatgtcgcaccttcactgaa
gaagaggtgtgtcacatctgtcaaaacccgaaacgtcaggaaaacggccaactttgtgtg
gtggaaagcccagcggatatcgctgcggtggaagcgaccggccagtactccggacgttac
tttgtgttgatggggcacctgtcaccactggatgggattggaccgagtgacattggcttg
gatgtgctggattttcgtcttcaacgcggcggaatttccgaagtgattctggccacaaac
ccgacggtggaaggcgaagcaaccgcacattacattgcagagttgtgccgcgaacatgac
gtgtcagccagccgaatcgctcacggcgtcccggttggcggcgagctggaattggtggat
ggcaccacgctgtctcactcattactcggccgacaaaagttgtaa

DBGET integrated database retrieval system