KEGG   Vibrio furnissii: vfu_A02799Help
Entry
vfu_A02799        CDS       T01680                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
vfu  Vibrio furnissii
Pathway
vfu00630  Glyoxylate and dicarboxylate metabolism
vfu01100  Metabolic pathways
vfu01110  Biosynthesis of secondary metabolites
vfu01120  Microbial metabolism in diverse environments
vfu01200  Carbon metabolism
Module
vfu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    vfu_A02799
Enzymes [BR:vfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     vfu_A02799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase TPR_14 ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: ADT87914
UniProt: F0LVX5
Position
1:complement(2909037..2910347)
Genome map
AA seq 436 aa AA seqDB search
MTLTRRQQIEALEKDWATNPRWKNVKRTYTAEEVVNLRGSVTPANTIAQRGADKLWSLVN
GDAKKGYVNCLGALTGGQAVQQAKAGIEAIYLSGWQVAADNNTAGTMYPDQSLYPVDSVP
SVVKRINNAFRRADQIQWSGGKSPEDEGGIDYYLPIVADAEAGFGGVLNAYELMKSMIDA
GAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGTTTLVIARTDANAA
DLLTSDCDPYDADFIVGERTSEGFYRVRAGIDQAIARGLAYSPYADLVWCETAKPDLEEA
RKFAEAIHAQYPDQLLAYNCSPSFNWEKNLDAETIAKFQQELADMGYKYQFITLAGIHNM
WFNMFELAHAYAQGEGMRHYVEMVQRREFQAAEKGYTFVAHQQEVGTGYFDKMTNTIQGG
QSSVTALTGSTEEDQF
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacactgactcgccgccaacaaattgaagcgctggaaaaagattgggcaaccaaccca
cgctggaaaaacgtaaaacgtacctatactgccgaagaagtggtgaacctgcgtggttcg
gtcacaccggccaatacaatcgcccagcgcggtgctgacaaactgtggtcgctggtgaat
ggcgacgcgaaaaaaggttacgtgaactgtctgggcgcgctgacgggcggtcaggcggtg
cagcaggcgaaagccggtatcgaagcgatttacctgtcgggctggcaggtggcggcggac
aacaataccgcaggcaccatgtacccagaccaatcgctttacccagtggactccgttcca
agcgtggtgaagcgtatcaacaatgcattccgccgtgccgaccaaattcagtggtcaggc
ggcaaatcaccagaagatgaaggtggaattgattactacctgccgatcgtggcggatgcg
gaagcgggctttggcggggtgttgaatgcctatgagctgatgaaatcgatgatcgatgca
ggcgctgcgggcgtgcactttgaagaccaattggcctccgtgaaaaaatgtggccacatg
ggcgggaaagtactggttccgacgcaagaagcggtgcaaaaattggtggcggcgcgattg
gcggctgacgtttctggcaccaccacgttggtgattgcacgtaccgatgccaacgcggct
gacctactgacgtcggattgtgacccatacgatgcggatttcatcgtcggtgagcgtacg
tcggaaggcttctaccgtgtgcgtgctggcattgaccaagcgatagcgcgtggtctggca
tattcaccttacgcggacttggtgtggtgtgaaacggcaaaaccggatctggaagaggcg
cgtaagttcgcagaagcgattcacgctcagtaccccgatcaactgctggcgtacaactgc
tcgccatcgttcaactgggagaaaaacctagacgcggaaaccattgcgaaattccagcaa
gagctggccgacatgggctacaaataccagttcattacgctggcgggcattcacaacatg
tggttcaacatgttcgaactggcacacgcgtacgcgcagggcgaaggcatgcgtcactac
gtggaaatggttcagcgccgtgaattccaagcggcagaaaaaggctacaccttcgtggct
caccaacaagaagtgggcaccggctactttgacaagatgaccaacaccattcaaggtggt
cagtcatcagtcactgccctgactggttcgaccgaagaagaccagttttaa

DBGET integrated database retrieval system