KEGG   Vibrio furnissii: vfu_A02800Help
Entry
vfu_A02800        CDS       T01680                                 

Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vfu  Vibrio furnissii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:vfu01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vfu00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:vfu00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2910468..2912105)
Genome map
AA seq 545 aa AA seqDB search
MLAQTPDKDLAHPQSTRREGLLEVTGALSSAHQAIFPVEAQTFLSELCAQFAPRVDTLLA
AREEKQSQIDHGQLPDFLPETQDIREGSWKILGIPQDLQDRRVEITGPTDRKMVINALNA
NVKVFMADFEDSMAPAWDKVLDGQINLRDAVNGTISYTNPDNGKRYELADDPAVLICRVR
GLHLKEKHVTFGERIIPGALFDFALYFFNNYKALLKKGSGPYFYLPKLQAYQEAQWWSDV
FHFTEDYFGLETGTIKATVLIETLPAVFQMDEILFSLKEHIVGLNCGRWDYIFSYIKTLK
KHSDRVLPDRQVVTMDKPFLNAYSRLLIYTCHKRGAFAMGGMAAFIPAKDPAENAKVLEK
IRNDKMLEATNGHDGTWVAHPGLASTAMDVFNHVLGERSNQLDVSRMSDAPIYADELLAP
CDGPRTEAGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHGKSL
DNGQQVTKQLFRDYLAEEIEVVKAEVGEPRFNAGRFEEAAQLMETLTTSDELTNFLTIPG
YDYLA
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctcaaacgccagacaaagatttagcacacccccaatcgacccgtcgcgaaggc
ctgcttgaggtgaccggagcactttcttcggcacatcaggcgattttccctgttgaagcc
caaacctttttatctgagttgtgtgctcagtttgctccgcgagtcgacacgctgctggca
gcgcgagaagaaaaacagagtcaaatcgaccacggtcaactgccagacttccttcccgag
acgcaagatattcgtgagggcagttggaaaatcttggggattccgcaagatctgcaagac
cgccgcgtggaaattaccggcccaactgatcgcaaaatggtgattaatgccctgaatgcg
aacgtgaaagtgtttatggcggacttcgaagactcgatggcgcctgcgtgggacaaagtg
ttagatggccaaatcaacttgcgcgatgcggtgaatggcaccatcagttacaccaatccg
gacaacggcaaacgttacgagttggctgatgaccctgccgtgctgatctgccgcgtacga
ggtttgcaccttaaagaaaaacacgtcacttttggtgagcgcatcattcccggcgcgttg
ttcgatttcgcactttatttcttcaacaactacaaagcgttgctgaaaaagggcagcggt
ccgtatttctacctgcctaaactacaagcataccaagaagcgcagtggtggagcgatgtg
ttccatttcaccgaagattactttggtttggaaacgggcaccatcaaggccacggtgctg
attgaaactttgcccgccgtgttccagatggatgagattctgttctcactcaaagagcat
atcgtcggcctgaactgcggccgctgggattacatctttagctacatcaaaaccttgaaa
aaacacagcgaccgcgtgctgccggatcgccaagtcgtgacgatggacaagccgttcctc
aacgcatactcacgtctgctgatctacacctgccacaagcgcggcgcgtttgcgatgggc
ggcatggcggctttcattccggccaaagatccggcggagaacgccaaggtgctagaaaaa
attcgcaacgacaaaatgttggaagcgaccaatggtcacgatggcacttgggtggcgcac
ccgggtttagccagcaccgcgatggacgtgttcaaccacgtattgggcgagcgcagtaac
caactggacgtgagccgcatgtcggatgcgccgatttacgctgatgagctgctggcgccg
tgtgacggcccgcgcacggaagcgggcatgcgccacaacattcgtgttgcgctgcaatac
atcgaagcttggatctccggcaatgggtgtgtgccgatctatggcctgatggaagatgcc
gccacggcagaaatttctcgcgcctcgatttggcaatggattcaacatggcaaatcgctc
gacaacggccagcaagtcacgaaacaactgttccgcgattatctggcggaggaaatcgag
gtggtgaaagcggaagtcggtgagccacgtttcaacgcgggccgctttgaagaagccgcg
caactgatggaaacgctgaccaccagcgatgaactgaccaatttcttaaccataccgggt
tacgactacttagcgtaa

DBGET integrated database retrieval system