KEGG   Vibrio furnissii: vfu_A02800Help
Entry
vfu_A02800        CDS       T01680                                 

Definition
(RefSeq) malate synthase A
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
vfu  Vibrio furnissii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    vfu_A02800
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    vfu_A02800
   00630 Glyoxylate and dicarboxylate metabolism
    vfu_A02800
Enzymes [BR:vfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     vfu_A02800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2910468..2912105)
Genome map
AA seq 545 aa AA seqDB search
MLAQTPDKDLAHPQSTRREGLLEVTGALSSAHQAIFPVEAQTFLSELCAQFAPRVDTLLA
AREEKQSQIDHGQLPDFLPETQDIREGSWKILGIPQDLQDRRVEITGPTDRKMVINALNA
NVKVFMADFEDSMAPAWDKVLDGQINLRDAVNGTISYTNPDNGKRYELADDPAVLICRVR
GLHLKEKHVTFGERIIPGALFDFALYFFNNYKALLKKGSGPYFYLPKLQAYQEAQWWSDV
FHFTEDYFGLETGTIKATVLIETLPAVFQMDEILFSLKEHIVGLNCGRWDYIFSYIKTLK
KHSDRVLPDRQVVTMDKPFLNAYSRLLIYTCHKRGAFAMGGMAAFIPAKDPAENAKVLEK
IRNDKMLEATNGHDGTWVAHPGLASTAMDVFNHVLGERSNQLDVSRMSDAPIYADELLAP
CDGPRTEAGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHGKSL
DNGQQVTKQLFRDYLAEEIEVVKAEVGEPRFNAGRFEEAAQLMETLTTSDELTNFLTIPG
YDYLA
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctcaaacgccagacaaagatttagcacacccccaatcgacccgtcgcgaaggc
ctgcttgaggtgaccggagcactttcttcggcacatcaggcgattttccctgttgaagcc
caaacctttttatctgagttgtgtgctcagtttgctccgcgagtcgacacgctgctggca
gcgcgagaagaaaaacagagtcaaatcgaccacggtcaactgccagacttccttcccgag
acgcaagatattcgtgagggcagttggaaaatcttggggattccgcaagatctgcaagac
cgccgcgtggaaattaccggcccaactgatcgcaaaatggtgattaatgccctgaatgcg
aacgtgaaagtgtttatggcggacttcgaagactcgatggcgcctgcgtgggacaaagtg
ttagatggccaaatcaacttgcgcgatgcggtgaatggcaccatcagttacaccaatccg
gacaacggcaaacgttacgagttggctgatgaccctgccgtgctgatctgccgcgtacga
ggtttgcaccttaaagaaaaacacgtcacttttggtgagcgcatcattcccggcgcgttg
ttcgatttcgcactttatttcttcaacaactacaaagcgttgctgaaaaagggcagcggt
ccgtatttctacctgcctaaactacaagcataccaagaagcgcagtggtggagcgatgtg
ttccatttcaccgaagattactttggtttggaaacgggcaccatcaaggccacggtgctg
attgaaactttgcccgccgtgttccagatggatgagattctgttctcactcaaagagcat
atcgtcggcctgaactgcggccgctgggattacatctttagctacatcaaaaccttgaaa
aaacacagcgaccgcgtgctgccggatcgccaagtcgtgacgatggacaagccgttcctc
aacgcatactcacgtctgctgatctacacctgccacaagcgcggcgcgtttgcgatgggc
ggcatggcggctttcattccggccaaagatccggcggagaacgccaaggtgctagaaaaa
attcgcaacgacaaaatgttggaagcgaccaatggtcacgatggcacttgggtggcgcac
ccgggtttagccagcaccgcgatggacgtgttcaaccacgtattgggcgagcgcagtaac
caactggacgtgagccgcatgtcggatgcgccgatttacgctgatgagctgctggcgccg
tgtgacggcccgcgcacggaagcgggcatgcgccacaacattcgtgttgcgctgcaatac
atcgaagcttggatctccggcaatgggtgtgtgccgatctatggcctgatggaagatgcc
gccacggcagaaatttctcgcgcctcgatttggcaatggattcaacatggcaaatcgctc
gacaacggccagcaagtcacgaaacaactgttccgcgattatctggcggaggaaatcgag
gtggtgaaagcggaagtcggtgagccacgtttcaacgcgggccgctttgaagaagccgcg
caactgatggaaacgctgaccaccagcgatgaactgaccaatttcttaaccataccgggt
tacgactacttagcgtaa

DBGET integrated database retrieval system