KEGG   Vibrio furnissii: vfu_A02833Help
Entry
vfu_A02833        CDS       T01680                                 

Definition
exodeoxyribonuclease V, 67 kDa subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vfu  Vibrio furnissii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    vfu_A02833
Enzymes [BR:vfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     vfu_A02833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2944365..2946521)
Genome map
AA seq 718 aa AA seqDB search
MMDVRLDFAQLSAQLKQLAAQGALRQLDYQFAHFLAQQTDAEMLSDHERAALMLAAAAVS
AELGRGHICLPLVDEQGNWVELASKLGVYGEAALPLNQLWLSVDWAALVARTSLIGARGE
AVPLMFDGQRLYLHRYWHYEVTLAARLQCFGTPMILKPMAVQNLRQRLDTLFARDYRFLQ
QALQRKGDTSALNQVGRQRLVCDMLDVVDESGLDWEAIDSVLQQAKRSEDFAPLETLVPQ
AHCLNWQKVAAAIALTRRFAVISGGPGTGKTTTVTKLLAALISQVQQAQHTPTIKLVAPT
GKAAARLTESIGKAVASLAVEPELKALIPTESSTIHRLLGAIPDSAEFRHHAGNRLHLDV
LVVDEASMVDLPMMVKLVDALPDSARLILLGDKDQLASVEAGAVLGDICSFLYQGYSKEQ
SRVLSELTGFQPAALSPRHADHRIADSLCMLQKSYRFDARSGIGQLAKAVNSGQAVWVDK
VWQDAFSDIQHFALSSEHYNQMLQSLVGAYSPYLALMATPLTSSQSMAEKARDALQAFGR
ARLLCAVREGDFGVSGLNYRMERALAARKKIKVQDEIWYAGRPVMVTRNDHGLGLYNGDI
GICLRDEQDEQQRLKVYFELPDGSVKAVLPSRVPQHETAYAMTIHKSQGSEFEFTVMILP
PEFSPILTRELIYTGITRAKNQLALYCDMGVLKRGIKLKTQRASGLVERLRDADEPVA
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgatggatgtccgtttggatttcgcgcagctgagcgcgcagttaaagcaactggcggcg
cagggcgcactgcgccagctcgattaccagtttgcgcatttccttgcacaacaaactgac
gcggagatgctgagcgatcacgagcgcgcggcgttgatgttggccgctgcggcggtcagt
gccgaactggggcgcggtcatatctgtttgccgctggttgatgaacagggcaactgggtt
gaactggcgagcaaattgggggtgtatggcgaggctgccctgccgctgaatcagctgtgg
ttgtctgtggattgggcggcgctggtggcgcgcacgtcgctgattggcgcacgcggtgaa
gcggtgccgctgatgtttgatggtcagcgcttgtacctgcatcgctattggcattatgaa
gtgaccttggcggcgcgtttgcagtgctttgggacacccatgatcttaaagcctatggca
gtccaaaaccttcgccagcgtctggatacgttgtttgcccgcgactatcgttttttacag
caagccttgcagcgtaagggagacacgtcggcattgaatcaggttggtcgtcagcgtctg
gtgtgcgatatgcttgatgtggtcgacgagtctgggctcgattgggaagcgattgatagt
gtgttgcaacaggccaaacgcagcgaagattttgcgccgctggagaccttggtgccccaa
gcgcactgtctgaattggcagaaagtggctgccgcgattgcgctgacgcgccgctttgcg
gtgatttctggcggtcccggcacgggcaaaacgaccaccgtgaccaaattgctggcggcg
ctgatcagtcaggtgcaacaagcgcagcacacgccgaccatcaagctggtggcaccgacc
gggaaagcggctgctcggttgactgaatcgatcgggaaagcggtggcaagcttagccgtc
gagcctgagctcaaagcgctgatccccaccgaatcgagcaccattcaccgcttgttgggg
gcgattcccgacagcgccgagtttcgccatcatgcaggcaatcgcctgcaccttgatgtg
ctggtggttgatgaggcgtcgatggtcgatttgccgatgatggttaaattggtcgatgcg
ctgccggacagtgcgcggctgattctgctcggcgataaagatcagttggcgtcggtggaa
gcgggcgccgtgctgggtgatatctgctcgtttctttatcaagggtacagcaaagagcag
agccgtgtgttgtctgagttgactggctttcagccggcggcgctcagcccgcgtcacgcc
gatcatcgcattgccgatagcttgtgcatgctgcaaaagagttaccggtttgatgcgcgc
tccggcattggtcagttggcgaaagccgtcaacagcggtcaggcggtgtgggtggataaa
gtatggcaggacgcatttagcgacattcaacactttgcgcttagcagcgagcactacaac
cagatgttgcaatctctggtgggcgcctattcgccgtatctggcgttgatggcaacgccg
ctcacgtcgtcgcaaagcatggcggaaaaagcgcgcgatgcgttgcaagcctttggccgc
gcgcgtttattgtgcgcggtgcgagaaggggattttggtgtcagcggcctcaactatcgc
atggaacgggcgctggcggcgcgcaagaaaatcaaagtgcaggatgaaatctggtatgcc
ggacgcccggtgatggtgacgcgcaacgatcatggccttggcctgtataacggcgatatc
ggaatttgtctgcgcgatgaacaagatgagcagcagcggctgaaagtttactttgaactg
cccgatggtagcgtcaaagcggtgttgccaagccgagtaccgcaacatgaaaccgcctat
gcgatgacgattcacaaatcgcagggcagtgaatttgagttcactgtgatgattctgccg
ccagaattcagcccgattctcacccgagagctgatttacactggcatcacccgcgccaaa
aaccaacttgcgctgtattgcgatatgggcgtgctcaaacgtggcattaagctcaaaacg
cagcgggcgagtggcttggtggaacgattgcgtgatgcggacgaaccggttgcgtga

DBGET integrated database retrieval system