KEGG   Vibrio furnissii: vfu_A03122Help
Entry
vfu_A03122        CDS       T01680                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vfu  Vibrio furnissii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    vfu_A03122
   00052 Galactose metabolism
    vfu_A03122
   00500 Starch and sucrose metabolism
    vfu_A03122
   00520 Amino sugar and nucleotide sugar metabolism
    vfu_A03122
Enzymes [BR:vfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     vfu_A03122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3256320..3257189
Genome map
AA seq 289 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIQAGMTGMCIVTGRGKH
SIMDHFDMNYELEHQIRGTNKEELLVDIRHIIETAQFTYIRQREMKGLGHAILTGRELVG
DEPFAVVLADDLCVNEDQGVLEQMVALYKQFRCSIVAVQEVPENETHKYGVIAGEMIKDD
LFRVDDMVEKPEAGTAPSNLAIIGRYILTPDIFELIENTEPGKGGEIQITDALLKQAKAG
CVLAYKFKGKRFDCGSVEGYIEATNYCFEHLYKKDQQTVELAKHSTKKS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaatgcctattcccggcagctggctatggcacacgtttcttacctgcaacc
aaatccatgccaaaagagatgatgcctgtcgtcaacaaacccctgattgaatacggcgtc
gaagaggcaattcaagcgggcatgacgggtatgtgcatcgtgaccggccgtggtaaacac
tcaatcatggatcacttcgacatgaactacgaactggaacaccagattcgtgggaccaac
aaagaagaactattagtcgatattcgccacattatcgaaaccgcgcaatttacttacatt
cgccaacgcgaaatgaaaggattaggccatgcgatcctcaccggacgtgaactggtgggt
gatgaacctttcgctgtggttctggcagacgatctgtgcgtcaacgaagatcaaggtgtc
cttgagcaaatggtcgcgctctacaaacaattccgctgctcaatcgtggccgtacaagaa
gtccctgaaaacgagacccacaaatacggcgtgattgctggcgaaatgatcaaagacgat
ctgttccgtgtcgatgacatggtcgaaaaaccggaggcaggcacggcgccaagcaatctg
gcgatcattggtcgttacatcctgacccccgatattttcgaactgatcgaaaataccgaa
ccgggcaaaggtggcgaaattcagatcaccgacgcgctgctgaaacaggcgaaagctggg
tgtgttctggcgtacaaattcaaaggcaaacgctttgattgtggtagcgttgaaggctac
atcgaagcaaccaactactgctttgaacacctgtacaaaaaagaccagcaaactgttgaa
ttggcaaaacattcaactaaaaaatcgtaa

DBGET integrated database retrieval system