KEGG   Vibrio furnissii: vfu_B00012Help
Entry
vfu_B00012        CDS       T01680                                 

Definition
(GenBank) arginase/agmatinase/formimionoglutamate hydrolase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
vfu  Vibrio furnissii
Pathway
vfu00220  Arginine biosynthesis
vfu00330  Arginine and proline metabolism
vfu01100  Metabolic pathways
vfu01110  Biosynthesis of secondary metabolites
vfu01130  Biosynthesis of antibiotics
vfu01230  Biosynthesis of amino acids
Module
vfu_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    vfu_B00012
   00330 Arginine and proline metabolism
    vfu_B00012
Enzymes [BR:vfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     vfu_B00012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADT88267
UniProt: F0M052
Position
2:9343..10266
Genome map
AA seq 307 aa AA seqDB search
MKRHFDIIGAPFNQLGFVTTQENTVDGLRRMDEMSWVGLTDWIKVRNDRWGADIVDQGDV
VISDEVHSLISCGNKDEALRVYAHDLTIKVLASYKNNRLPITIGGDHSIAMGTIQAVLSH
YQKGKNKKIAIVWVDAHADCNNTRDSNLHGKPLALLMNQYPHNGWSIPSGITLNPQDVFY
VGVRDLMPCEHQLIQKLNMTSFDMMCIEQQGFHVVVRTLMEKLERAYDGIYLSFDYDVLD
GSLFRACATPNVGGLTAREALYLVHSIASSDKFIGAEFVEYMPERDSSGVSKELMVKLVD
AAWGFKS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacatttcgacatcatcggagcacctttcaatcaactgggttttgtgacaact
caagaaaatacggttgatggtctgcgacgaatggatgaaatgtcatgggtaggccttacg
gactggatcaaagttagaaatgaccgatggggtgctgacatcgttgaccaaggcgatgtt
gtcatctccgatgaggttcattcattgatttcctgcgggaacaaagatgaagcattgcga
gtttacgcgcacgacctaacgataaaggtgctggcaagttataagaataatcggctcccc
ataacaattggtggcgaccactcgatagcgatgggtacaattcaagcagtgctaagccat
tatcaaaagggcaaaaataaaaaaattgcaattgtttgggttgatgctcacgctgattgc
aacaacactcgcgacagcaatttgcacggtaagccgttagcattattaatgaatcaatat
ccgcacaatggttggtcaataccttctggtatcaccttaaaccctcaagacgtgttttat
gtgggcgtcagagatttaatgccatgtgaacatcaactcattcaaaaactcaatatgacc
agcttcgacatgatgtgtatcgaacagcaagggtttcatgttgtcgttcgaaccttaatg
gaaaaattggagcgcgcgtatgacggtatttacctgtcattcgattacgatgtcttagat
ggttctctatttcgagcatgtgctacgccgaatgttggtggtttaaccgcaagagaggcc
ctgtatttagttcattcaatcgcctcgagtgacaagtttattggagcagagtttgttgaa
tacatgcccgaacgagacagtagtggggtatccaaggagttgatggtgaagcttgttgat
gcggcttggggatttaagtcgtag

DBGET integrated database retrieval system