KEGG   Vibrio furnissii: vfu_B00306Help
Entry
vfu_B00306        CDS       T01680                                 

Definition
delta-9 fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vfu  Vibrio furnissii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    vfu_B00306
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    vfu_B00306
Enzymes [BR:vfu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     vfu_B00306
Lipid biosynthesis proteins [BR:vfu01004]
 Desaturase
  First
   vfu_B00306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:305692..306813
Genome map
AA seq 373 aa AA seqDB search
MANKPPLIWLNITIFTVSFVLAAVVAPWYGWQNGYGWEYLIWLIVCFSFCNLSITTGYHR
LWSHKAFEAHWSVRFLCALGGAFAVQNSALHWASDHRVHHKFVDQNDKDPYSAKRGFWFS
HMGWMLRDYHPATYDDYSNCRDLHKDKIVMWQHRFYVPLALLMNFGVPIALGWYYNDVWG
MLLIVGAVRLVLNHHTTFFINSLAHIWGKQPYTNKNTARDNGILAFFTFGEGYHNYHHIF
ENDYRNGIYWWQYDPTKWLIKTCAWLGLAKKLRTAPAIKIEKARAEMSLKYATERVALLP
NHLLILANVQAEFDAFIHELHNYYDVKKQLLESKKSSALKRYEHSVLKARYQSVKTELME
KRQRWQQTVAQYA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataaaccgcctttaatttggttgaacatcacgatcttcaccgtgagtttcgtt
ctggccgctgttgtcgcgccttggtatggctggcagaacggctatggatgggagtatcta
atctggctcattgtctgcttttcgttttgcaatttatccatcacaaccgggtatcatcgt
ctgtggtctcacaaagcgtttgaagcacactggtccgtgcgtttcttgtgtgcactgggt
ggcgcgttcgcagtacaaaacagtgccctgcattgggcgtcggatcaccgcgttcaccac
aagtttgtcgatcaaaacgacaaagatccttactcggccaagcgcgggttctggttttca
cacatgggctggatgttaagagactatcaccccgccacgtatgacgattacagcaactgc
cgcgatctgcacaaagataagattgtgatgtggcaacatcgcttttatgtcccattggca
ctgctgatgaacttcggcgtcccgattgcgctgggttggtactacaacgatgtttggggc
atgttgttgattgttggcgcagtgcgtttggtgctgaatcatcacaccacattctttatt
aactcgctggcacacatttggggcaaacagccttacaccaacaaaaatacggcgcgtgat
aacggtatcttggcctttttcacctttggcgagggttaccacaattaccaccatattttt
gaaaatgactatcgcaacggcatttattggtggcaatacgacccaaccaaatggttgatc
aagacctgcgcgtggcttggcttggcgaagaaactgcgcactgcaccggcgattaaaatc
gagaaagcgcgtgcggagatgagcttgaaatatgccaccgaacgcgtggcgctgctgccg
aatcacctgctgattctggccaacgttcaagcggagtttgatgcgtttattcacgaactg
cacaattactacgatgtgaaaaaacaactgttggaaagcaagaagagttcagcgctaaag
cgttatgaacattcggtgctcaaagcacgttatcaatctgtaaaaacagaattgatggaa
aaacgacaacgttggcagcaaacggttgctcaatacgcataa

DBGET integrated database retrieval system