KEGG   Vibrio furnissii: vfu_B00306Help
Entry
vfu_B00306        CDS       T01680                                 

Definition
delta-9 fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vfu  Vibrio furnissii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:vfu01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:vfu01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:305692..306813
Genome map
AA seq 373 aa AA seqDB search
MANKPPLIWLNITIFTVSFVLAAVVAPWYGWQNGYGWEYLIWLIVCFSFCNLSITTGYHR
LWSHKAFEAHWSVRFLCALGGAFAVQNSALHWASDHRVHHKFVDQNDKDPYSAKRGFWFS
HMGWMLRDYHPATYDDYSNCRDLHKDKIVMWQHRFYVPLALLMNFGVPIALGWYYNDVWG
MLLIVGAVRLVLNHHTTFFINSLAHIWGKQPYTNKNTARDNGILAFFTFGEGYHNYHHIF
ENDYRNGIYWWQYDPTKWLIKTCAWLGLAKKLRTAPAIKIEKARAEMSLKYATERVALLP
NHLLILANVQAEFDAFIHELHNYYDVKKQLLESKKSSALKRYEHSVLKARYQSVKTELME
KRQRWQQTVAQYA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataaaccgcctttaatttggttgaacatcacgatcttcaccgtgagtttcgtt
ctggccgctgttgtcgcgccttggtatggctggcagaacggctatggatgggagtatcta
atctggctcattgtctgcttttcgttttgcaatttatccatcacaaccgggtatcatcgt
ctgtggtctcacaaagcgtttgaagcacactggtccgtgcgtttcttgtgtgcactgggt
ggcgcgttcgcagtacaaaacagtgccctgcattgggcgtcggatcaccgcgttcaccac
aagtttgtcgatcaaaacgacaaagatccttactcggccaagcgcgggttctggttttca
cacatgggctggatgttaagagactatcaccccgccacgtatgacgattacagcaactgc
cgcgatctgcacaaagataagattgtgatgtggcaacatcgcttttatgtcccattggca
ctgctgatgaacttcggcgtcccgattgcgctgggttggtactacaacgatgtttggggc
atgttgttgattgttggcgcagtgcgtttggtgctgaatcatcacaccacattctttatt
aactcgctggcacacatttggggcaaacagccttacaccaacaaaaatacggcgcgtgat
aacggtatcttggcctttttcacctttggcgagggttaccacaattaccaccatattttt
gaaaatgactatcgcaacggcatttattggtggcaatacgacccaaccaaatggttgatc
aagacctgcgcgtggcttggcttggcgaagaaactgcgcactgcaccggcgattaaaatc
gagaaagcgcgtgcggagatgagcttgaaatatgccaccgaacgcgtggcgctgctgccg
aatcacctgctgattctggccaacgttcaagcggagtttgatgcgtttattcacgaactg
cacaattactacgatgtgaaaaaacaactgttggaaagcaagaagagttcagcgctaaag
cgttatgaacattcggtgctcaaagcacgttatcaatctgtaaaaacagaattgatggaa
aaacgacaacgttggcagcaaacggttgctcaatacgcataa

DBGET integrated database retrieval system