KEGG   Vibrio furnissii: vfu_B00320Help
Entry
vfu_B00320        CDS       T01680                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vfu  Vibrio furnissii
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    vfu_B00320
   00630 Glyoxylate and dicarboxylate metabolism
    vfu_B00320
   00640 Propanoate metabolism
    vfu_B00320
   00650 Butanoate metabolism
    vfu_B00320
  Lipid metabolism
   00071 Fatty acid degradation
    vfu_B00320
   00072 Synthesis and degradation of ketone bodies
    vfu_B00320
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    vfu_B00320
   00310 Lysine degradation
    vfu_B00320
   00380 Tryptophan metabolism
    vfu_B00320
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    vfu_B00320
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    vfu_B00320
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    vfu_B00320
Enzymes [BR:vfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     vfu_B00320
Exosome [BR:vfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   vfu_B00320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(320619..321824)
Genome map
AA seq 401 aa AA seqDB search
MEKVFIVAAKRSPIGAFGGTLKNVPAGKLAADVIKGALQAGNVDVNHVDEVIIGHVISAG
QGMGVGRQAAMFAGIPEEVPAYGVNMVCGSGMKTVMDAVAHIRAGDISVAVAGGVEVMSQ
IPFVTPSSLRDGQKMGGFEMKDLLINDGLTDVFNQYHMGVTAENIAKQFEITRDAQDAFA
LESQQKAVAAIEAGKFNDEIVPIAVQQRRDTITFFVDEYPKAGATLAGLQGLRPAFDKEG
SVTAGNASGINDGASAIIVASQSAVDEYGFEPLAEILGYAQTGIDPRVMGLGPVSAVTQA
LEKAELGIDQIDLFELNEAFAAQALGVVHGLSAEHNVSTDSILAKSNVNGGAIALGHPLG
ASGNRILVTLVHELKRRGNDYGVASLCVGGGMGTAIVIKAL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtatttattgttgctgccaaacgcagcccaattggtgcctttggcggaacg
ttgaaaaatgtacccgctggcaagttggccgccgatgtcatcaaaggcgcgctacaggca
ggtaatgtcgatgtaaatcacgttgatgaagtgatcatagggcatgtgatcagtgccggt
caaggaatgggcgtggggcgtcaagccgccatgtttgccggtattcccgaggaagtccca
gcgtatggcgtcaatatggtgtgtggcagtggcatgaaaacggtcatggatgcggtggcg
catattcgtgctggcgacatttcggtggccgtcgccggtggtgtggaagtgatgtcacaa
atcccgtttgtgacaccgagttccctgcgcgatggccaaaaaatgggcggctttgaaatg
aaagatctgctcatcaacgatggtttaaccgatgtgttcaaccaataccacatgggcgtg
actgcagagaatatcgccaagcaatttgagatcacgcgtgatgcgcaagatgcgtttgcg
ctagagagtcagcaaaaagcagtcgcagccattgaagcgggcaagttcaacgatgagatt
gtccccatcgccgtgcaacagcgccgtgacaccatcacttttttcgtcgatgagtacccc
aaagcgggtgcaacgctcgctggtctgcaagggttgcgtcctgcgtttgataaagaaggc
tcggtgacggctggcaatgcgtcgggcatcaatgatggtgccagtgcaatcatcgtcgca
tcacaatcggcggttgacgagtatggttttgaacccttggcggaaatcttgggttatgcc
caaaccggtatcgatccgcgcgtcatggggcttggtcctgtcagtgcggtgacacaagcg
ctggaaaaagcagagctgggcatcgatcaaattgacctatttgagctcaatgaagccttt
gccgctcaggcattaggagtggttcacgggttgtcggcggaacataacgtgtcaaccgat
tccattttggccaagtcgaatgtcaatgggggcgcaatcgccctcgggcatccgctgggc
gcgtcaggtaaccgcattctggttacgttagttcacgagttaaaacgtcgcggtaacgat
tacggtgtagcatccctgtgtgtgggtggtggcatgggtacggcgatcgttattaaagcg
ttgtaa

DBGET integrated database retrieval system