KEGG   Vibrio furnissii: vfu_B00337Help
Entry
vfu_B00337        CDS       T01680                                 

Definition
(GenBank) pyrazinamidase/nicotinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
vfu  Vibrio furnissii
Pathway
vfu00760  Nicotinate and nicotinamide metabolism
vfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    vfu_B00337
Enzymes [BR:vfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     vfu_B00337
    3.5.1.-  
     vfu_B00337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase 3Beta_HSD
Motif
Other DBs
NCBI-ProteinID: ADT88579
UniProt: F0LXD0
Position
2:complement(342761..343387)
Genome map
AA seq 208 aa AA seqDB search
MSKTLILVDVQNDFAPGGALAVPEGDVIVPVINRLLPHFDHVIATKDWHPADHASFASVQ
GKSIGDMVDLDGVSQIMWPDHCVQHTDGAAFIPGLNTDEIEYVVYKGTHSAIDSYSGFFD
NQRQQSTGLADYLKDKGIDDVYIVGLATDYCVKFTALDAASLGLQTTVIADACRGVNLSP
DDSHQAFEAMKASGCRVISSDEFLASIG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagacgctaattttagttgatgtgcagaatgattttgcaccgggtggcgcattg
gcggtaccggaaggtgatgtgattgttccggtcattaatcgacttctccctcattttgat
catgtcattgcgaccaaggattggcatcctgcggatcatgcgagttttgcttcagtgcaa
ggcaaatcgattggcgatatggtggatctcgacggggtcagccaaatcatgtggccggat
cactgcgtgcagcataccgatggtgcggcgtttattcccggtttaaacactgacgagatc
gagtatgtggtgtacaaaggcacccattcggcgatcgacagctacagcggtttttttgat
aaccaacgccagcaaagtaccggactggccgattacttgaaagacaagggcattgacgac
gtttacattgtcggtttggcgacggattactgcgtgaaatttaccgcactcgatgccgca
tcgttggggcttcaaaccacagtgattgccgatgcgtgtcgcggcgtgaacctgtctccg
gatgattcccatcaagcattcgaagcgatgaaggcgtccggatgccgcgtgatctcctcc
gatgaatttctggcatcaatcggctaa

DBGET integrated database retrieval system