KEGG   Vibrio furnissii: vfu_B00337Help
Entry
vfu_B00337        CDS       T01680                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
vfu  Vibrio furnissii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    vfu_B00337
Enzymes [BR:vfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     vfu_B00337
    3.5.1.-  
     vfu_B00337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(342761..343387)
Genome map
AA seq 208 aa AA seqDB search
MSKTLILVDVQNDFAPGGALAVPEGDVIVPVINRLLPHFDHVIATKDWHPADHASFASVQ
GKSIGDMVDLDGVSQIMWPDHCVQHTDGAAFIPGLNTDEIEYVVYKGTHSAIDSYSGFFD
NQRQQSTGLADYLKDKGIDDVYIVGLATDYCVKFTALDAASLGLQTTVIADACRGVNLSP
DDSHQAFEAMKASGCRVISSDEFLASIG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagacgctaattttagttgatgtgcagaatgattttgcaccgggtggcgcattg
gcggtaccggaaggtgatgtgattgttccggtcattaatcgacttctccctcattttgat
catgtcattgcgaccaaggattggcatcctgcggatcatgcgagttttgcttcagtgcaa
ggcaaatcgattggcgatatggtggatctcgacggggtcagccaaatcatgtggccggat
cactgcgtgcagcataccgatggtgcggcgtttattcccggtttaaacactgacgagatc
gagtatgtggtgtacaaaggcacccattcggcgatcgacagctacagcggtttttttgat
aaccaacgccagcaaagtaccggactggccgattacttgaaagacaagggcattgacgac
gtttacattgtcggtttggcgacggattactgcgtgaaatttaccgcactcgatgccgca
tcgttggggcttcaaaccacagtgattgccgatgcgtgtcgcggcgtgaacctgtctccg
gatgattcccatcaagcattcgaagcgatgaaggcgtccggatgccgcgtgatctcctcc
gatgaatttctggcatcaatcggctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system