KEGG   Vibrio furnissii: vfu_B00620Help
Entry
vfu_B00620        CDS       T01680                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vfu  Vibrio furnissii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    vfu_B00620
Enzymes [BR:vfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     vfu_B00620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(642293..643219)
Genome map
AA seq 308 aa AA seqDB search
MNDLFTKTDYSLYSNAMTFVRRPYERNPIDTDADVVVLGVPLDMATSGRPGARMGPDAIR
RASVNLAWEGKKFPWDFNLFNRINVVDAGDLVFDCGDAEDFTYRLEAATNEILKSGKTML
ALGGDHFITLPILRAYAKHHGEMALIHFDAHTDTYANGSAYDHGTMFYHAPKEGLISPKH
SVQVGIRTEYKQEGHGFNVINAMQANDMSVDEIVGQIKHIVGDKPVYLTFDIDCLDPAFA
PGTGTPVCGGLTSDKILKIIRALKGINMVGMDVVEVSPPYDQSDLTSLAGATIALELLYV
WASNKPAE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatttgtttactaaaactgattattcactgtattcaaatgcgatgacgtttgtg
cgtcgtccttacgaacgcaaccccattgatactgacgctgatgtcgtggtgctgggtgtg
ccgcttgacatggcgacctcgggccgtcctggcgcgcgcatggggccggatgcgattcgt
cgcgcgtcggtgaacctcgcgtgggaaggcaaaaaattcccgtgggattttaacctgttc
aatcgcatcaatgtggtggatgcaggggatttggtgtttgactgtggtgacgcagaagat
ttcacatatcgcttggaagcggcgaccaacgagatcctgaaaagcggcaagaccatgctg
gcgctgggcggtgaccatttcatcacactgcctatcctgcgtgcttacgcaaaacatcac
ggtgaaatggcattgattcattttgacgcccacaccgatacttacgcgaacggcagtgcg
tacgaccacggcaccatgttctatcatgcgccgaaagaaggcctgatttcaccgaaacat
tcggtgcaagtcggcattcgtaccgaatacaagcaagaaggtcacggctttaacgtgatc
aacgcgatgcaagccaacgacatgtcggtggatgagatcgtcggtcaaatcaaacacatc
gtgggtgacaagcccgtgtatctgacattcgatatcgactgtctggatcctgcgtttgcg
ccggggacggggacgcctgtgtgtggcggtctgacttcagacaaaatcttgaagattatt
cgcgcactgaaaggcatcaacatggtggggatggacgtggtggaagtgtcaccgccgtat
gaccagagcgatttgacctctctggctggggcgaccattgcactggaactgctctacgtg
tgggcatccaacaaaccggctgagtaa

DBGET integrated database retrieval system