KEGG   Vibrio furnissii: vfu_B00633Help
Entry
vfu_B00633        CDS       T01680                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
vfu  Vibrio furnissii
Pathway
vfu00860  Porphyrin and chlorophyll metabolism
vfu01100  Metabolic pathways
vfu01110  Biosynthesis of secondary metabolites
vfu01120  Microbial metabolism in diverse environments
Module
vfu_M00121  Heme biosynthesis, glutamate => heme
vfu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    vfu_B00633
Enzymes [BR:vfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     vfu_B00633
Exosome [BR:vfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   vfu_B00633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ADT88857
UniProt: F0LY58
Position
2:657864..658850
Genome map
AA seq 328 aa AA seqDB search
MESQSHQVLMKRPRRLRAHQHIRHMVQETQLNKSDLIQPIFVEEGIDAPVAIDALPGVCR
IPESHIADEVTALYELGIRYVMPFGISHHKDECGSDTWHDNGLLSRMIKSIKTVCPDMIV
IPDICFCEYTTHGHCGVVHDGSVDNDKTVENLVKQSVAAAKAGADMLAPSAMMDGQVGAI
RRGLDAAGFPNVSIMAHAIKFASAFYGPFRSAVECTLEGNRDTYQADPHNGRQALVEAAL
DEEEGADILMVKPGTPYLDVLKSLSDNTRLPLAVYQVSGEYAILKTAAQAGLLDEKRAVL
ETMIGFKRAGASVIVTYYAKELAQWLSE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtcagtctcatcaagtattaatgaaacgtccacgccgcctgcgcgcgcatcaa
cacattcgtcacatggtgcaggaaactcagctcaacaagagcgatttgattcaacccatt
tttgtcgaagagggcattgacgcgcccgtcgcgattgacgcgctgcccggcgtatgccgc
attccagaatcccacatcgccgatgaagtgacggcgctgtatgaactcggcattcgctac
gtgatgccatttggcatttcgcatcacaaagatgagtgtggctccgacacatggcacgac
aacggcttgctcagccgcatgatcaaatcgatcaaaaccgtatgccccgacatgattgtg
atccccgatatctgtttttgtgaatacaccacgcatggccattgcggggtggtgcacgac
gggtcagtcgataacgacaaaaccgttgagaacctcgtgaagcagtctgttgcagcagcg
aaagcaggcgcagacatgttggcgccatctgcaatgatggatggtcaagtcggcgcgatt
cgccgtggcctcgacgcggcagggttcccgaatgtgagcatcatggcgcacgcgatcaaa
tttgcctccgcattctatggcccattccgctccgcggtggaatgcacgctggaaggcaac
cgcgatacctatcaagccgatccgcacaatggtcgccaagccttggttgaagcggcattg
gatgaagaagaaggcgcagatattctgatggtgaaacccggcacgccgtatctggatgtg
ctgaaatcgctcagcgacaacacgcgcctgccactggcggtgtatcaagtcagcggtgaa
tacgcgattttgaaaacagcggcgcaagctggcctgttagatgagaaacgcgcggtactg
gaaaccatgattggctttaaacgcgctggcgcgagtgtgatagtcacctactacgcgaaa
gagctggcgcagtggctgagtgaataa

DBGET integrated database retrieval system