KEGG   Vibrio furnissii: vfu_B00633Help
Entry
vfu_B00633        CDS       T01680                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
vfu  Vibrio furnissii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:vfu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:657864..658850
Genome map
AA seq 328 aa AA seqDB search
MESQSHQVLMKRPRRLRAHQHIRHMVQETQLNKSDLIQPIFVEEGIDAPVAIDALPGVCR
IPESHIADEVTALYELGIRYVMPFGISHHKDECGSDTWHDNGLLSRMIKSIKTVCPDMIV
IPDICFCEYTTHGHCGVVHDGSVDNDKTVENLVKQSVAAAKAGADMLAPSAMMDGQVGAI
RRGLDAAGFPNVSIMAHAIKFASAFYGPFRSAVECTLEGNRDTYQADPHNGRQALVEAAL
DEEEGADILMVKPGTPYLDVLKSLSDNTRLPLAVYQVSGEYAILKTAAQAGLLDEKRAVL
ETMIGFKRAGASVIVTYYAKELAQWLSE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtcagtctcatcaagtattaatgaaacgtccacgccgcctgcgcgcgcatcaa
cacattcgtcacatggtgcaggaaactcagctcaacaagagcgatttgattcaacccatt
tttgtcgaagagggcattgacgcgcccgtcgcgattgacgcgctgcccggcgtatgccgc
attccagaatcccacatcgccgatgaagtgacggcgctgtatgaactcggcattcgctac
gtgatgccatttggcatttcgcatcacaaagatgagtgtggctccgacacatggcacgac
aacggcttgctcagccgcatgatcaaatcgatcaaaaccgtatgccccgacatgattgtg
atccccgatatctgtttttgtgaatacaccacgcatggccattgcggggtggtgcacgac
gggtcagtcgataacgacaaaaccgttgagaacctcgtgaagcagtctgttgcagcagcg
aaagcaggcgcagacatgttggcgccatctgcaatgatggatggtcaagtcggcgcgatt
cgccgtggcctcgacgcggcagggttcccgaatgtgagcatcatggcgcacgcgatcaaa
tttgcctccgcattctatggcccattccgctccgcggtggaatgcacgctggaaggcaac
cgcgatacctatcaagccgatccgcacaatggtcgccaagccttggttgaagcggcattg
gatgaagaagaaggcgcagatattctgatggtgaaacccggcacgccgtatctggatgtg
ctgaaatcgctcagcgacaacacgcgcctgccactggcggtgtatcaagtcagcggtgaa
tacgcgattttgaaaacagcggcgcaagctggcctgttagatgagaaacgcgcggtactg
gaaaccatgattggctttaaacgcgctggcgcgagtgtgatagtcacctactacgcgaaa
gagctggcgcagtggctgagtgaataa

DBGET integrated database retrieval system