KEGG   Vibrio furnissii: vfu_B00763Help
Entry
vfu_B00763        CDS       T01680                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
vfu  Vibrio furnissii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:793073..794032
Genome map
AA seq 319 aa AA seqDB search
MMKHHVAATPANYALWYTYVDNTIPRLNQEMDVVLDNFGLCPPASGDYLYKQFIASKAET
SVGDLRANIELLVSEVASSMSDTMTDTTAFEAIIDKSFRDLERVENENLSIEEVMTLIRQ
LVSESRDIRHSTRFLNSQLKNASEEITRLKTQLAEVQKDALFDGLSGLYNRRSFDDDLSA
MLHAQQSISIVLLDIDHFKTYNDDFGHLFGDTVIRALAKRIQSSCREGITAYRFGGEEFA
LLVPNRSLRSARQFADALRRSIEKLSVRDRRTGMQVGNITASFGVAESEPNDTLDMLIDR
ADKMLYEAKNLGRNRVMPL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacatcatgtcgcggcaacaccggctaactacgccctttggtatacctatgtc
gacaacaccattcctcgcctcaaccaggaaatggatgttgtgttagacaacttcgggctg
tgcccgccagcatctggcgactacctttacaaacaatttattgccagcaaagccgaaacc
agcgtgggcgatctgcgcgccaatattgagctgctggtgagcgaagtcgccagttccatg
tcggacaccatgaccgacaccacggcgtttgaagccattattgataaaagctttcgcgat
ctggaacgggttgaaaacgagaacttgtcgattgaagaagtgatgacgctgatccgccaa
ctggtgagtgaatcacgcgatattcgccactcgacacgctttctcaacagtcagttaaaa
aacgccagcgaagagatcacgcgcctgaaaacccaattggccgaagtgcaaaaagatgcc
ctgtttgatggcttatccgggttgtacaaccgtcgttcatttgacgacgacttgagcgcc
atgctgcatgcgcagcaatctatcagcattgtgctgcttgatattgaccacttcaaaacc
tacaacgacgattttggccacctgtttggcgataccgtcattcgcgcgctggccaaacgc
attcaatcaagctgccgtgaaggcattacggcgtatcgttttggcggcgaagagtttgcc
ttgctggtgccaaatcgttcactacgcagcgcgcgtcagtttgcggatgccctgcgtcgt
tccattgaaaagttgagcgtgcgcgatcgccgcaccggcatgcaagtcgggaacattacg
gcgtcgtttggcgtggcagaaagcgaacccaatgacacgttggatatgctcatcgatcgc
gccgacaagatgctctacgaagcaaaaaatcttggccgtaaccgtgtgatgccactataa

DBGET integrated database retrieval system