KEGG   Vibrio furnissii: vfu_B00763Help
Entry
vfu_B00763        CDS       T01680                                 

Definition
(GenBank) GGDEF family protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
vfu  Vibrio furnissii
Brite
Enzymes [BR:vfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     vfu_B00763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:793073..794032
Genome map
AA seq 319 aa AA seqDB search
MMKHHVAATPANYALWYTYVDNTIPRLNQEMDVVLDNFGLCPPASGDYLYKQFIASKAET
SVGDLRANIELLVSEVASSMSDTMTDTTAFEAIIDKSFRDLERVENENLSIEEVMTLIRQ
LVSESRDIRHSTRFLNSQLKNASEEITRLKTQLAEVQKDALFDGLSGLYNRRSFDDDLSA
MLHAQQSISIVLLDIDHFKTYNDDFGHLFGDTVIRALAKRIQSSCREGITAYRFGGEEFA
LLVPNRSLRSARQFADALRRSIEKLSVRDRRTGMQVGNITASFGVAESEPNDTLDMLIDR
ADKMLYEAKNLGRNRVMPL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacatcatgtcgcggcaacaccggctaactacgccctttggtatacctatgtc
gacaacaccattcctcgcctcaaccaggaaatggatgttgtgttagacaacttcgggctg
tgcccgccagcatctggcgactacctttacaaacaatttattgccagcaaagccgaaacc
agcgtgggcgatctgcgcgccaatattgagctgctggtgagcgaagtcgccagttccatg
tcggacaccatgaccgacaccacggcgtttgaagccattattgataaaagctttcgcgat
ctggaacgggttgaaaacgagaacttgtcgattgaagaagtgatgacgctgatccgccaa
ctggtgagtgaatcacgcgatattcgccactcgacacgctttctcaacagtcagttaaaa
aacgccagcgaagagatcacgcgcctgaaaacccaattggccgaagtgcaaaaagatgcc
ctgtttgatggcttatccgggttgtacaaccgtcgttcatttgacgacgacttgagcgcc
atgctgcatgcgcagcaatctatcagcattgtgctgcttgatattgaccacttcaaaacc
tacaacgacgattttggccacctgtttggcgataccgtcattcgcgcgctggccaaacgc
attcaatcaagctgccgtgaaggcattacggcgtatcgttttggcggcgaagagtttgcc
ttgctggtgccaaatcgttcactacgcagcgcgcgtcagtttgcggatgccctgcgtcgt
tccattgaaaagttgagcgtgcgcgatcgccgcaccggcatgcaagtcgggaacattacg
gcgtcgtttggcgtggcagaaagcgaacccaatgacacgttggatatgctcatcgatcgc
gccgacaagatgctctacgaagcaaaaaatcttggccgtaaccgtgtgatgccactataa

DBGET integrated database retrieval system