KEGG   Vibrio furnissii: vfu_B00764Help
Entry
vfu_B00764        CDS       T01680                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
vfu  Vibrio furnissii
Pathway
vfu00620  Pyruvate metabolism
vfu00630  Glyoxylate and dicarboxylate metabolism
vfu01100  Metabolic pathways
vfu01110  Biosynthesis of secondary metabolites
vfu01120  Microbial metabolism in diverse environments
vfu01200  Carbon metabolism
Module
vfu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    vfu_B00764
   00630 Glyoxylate and dicarboxylate metabolism
    vfu_B00764
Enzymes [BR:vfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     vfu_B00764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1140
Motif
Other DBs
NCBI-ProteinID: ADT88978
UniProt: F0LYH9
Position
2:complement(794162..794740)
Genome map
AA seq 192 aa AA seqDB search
MNMLTFDKTEIQKQQKPFIAEAVFAVETISANQQREKQLKAKQLLDRLFPLETGSHQDVT
SYVIDYHHVLAYFKDGRHSGLKHPKHFIAFTGGKDNPCSILFRDGSGCHVEVMLGCQKGT
GCVELVEIDDIQLETCTTFTQMSEDTTPTAAMRHWISLIKGDERGKPQACSEDKEYTAKS
GEDYYLNYCFNL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgctgactttcgataaaacagaaatccaaaaacaacagaaaccctttatcgct
gaagcagtcttcgccgtcgagacaatcagcgcaaaccagcaacgtgaaaaacagctgaaa
gcgaagcaattgcttgaccgtctgttcccgttggaaacagggtcacaccaggacgttacc
agctacgtgattgattaccaccatgtcttggcgtatttcaaagacggtcgccacagtggc
ttgaagcatccgaaacacttcattgcgtttaccggtggcaaagataacccatgttcgatt
ctgttccgtgacggcagcggctgccacgtggaagtgatgctgggttgccagaaaggcacg
gggtgtgttgagttggtggagattgacgacattcaattggaaacctgcaccacgttcaca
caaatgagcgaggacaccacgcctaccgccgcgatgcgtcactggatcagtctgatcaaa
ggggatgaacgcggtaaaccgcaggcttgcagtgaagacaaagaatacaccgcgaaaagc
ggcgaagattactacttaaactactgcttcaacctgtaa

DBGET integrated database retrieval system