KEGG   Vibrio furnissii: vfu_B00764Help
Entry
vfu_B00764        CDS       T01680                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
vfu  Vibrio furnissii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    vfu_B00764
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    vfu_B00764
   00630 Glyoxylate and dicarboxylate metabolism
    vfu_B00764
Enzymes [BR:vfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     vfu_B00764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(794162..794740)
Genome map
AA seq 192 aa AA seqDB search
MNMLTFDKTEIQKQQKPFIAEAVFAVETISANQQREKQLKAKQLLDRLFPLETGSHQDVT
SYVIDYHHVLAYFKDGRHSGLKHPKHFIAFTGGKDNPCSILFRDGSGCHVEVMLGCQKGT
GCVELVEIDDIQLETCTTFTQMSEDTTPTAAMRHWISLIKGDERGKPQACSEDKEYTAKS
GEDYYLNYCFNL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgctgactttcgataaaacagaaatccaaaaacaacagaaaccctttatcgct
gaagcagtcttcgccgtcgagacaatcagcgcaaaccagcaacgtgaaaaacagctgaaa
gcgaagcaattgcttgaccgtctgttcccgttggaaacagggtcacaccaggacgttacc
agctacgtgattgattaccaccatgtcttggcgtatttcaaagacggtcgccacagtggc
ttgaagcatccgaaacacttcattgcgtttaccggtggcaaagataacccatgttcgatt
ctgttccgtgacggcagcggctgccacgtggaagtgatgctgggttgccagaaaggcacg
gggtgtgttgagttggtggagattgacgacattcaattggaaacctgcaccacgttcaca
caaatgagcgaggacaccacgcctaccgccgcgatgcgtcactggatcagtctgatcaaa
ggggatgaacgcggtaaaccgcaggcttgcagtgaagacaaagaatacaccgcgaaaagc
ggcgaagattactacttaaactactgcttcaacctgtaa

DBGET integrated database retrieval system